Gene/Proteome Database (LMPD)

LMPD ID
LMP009833
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
alpha/beta-Hydrolases superfamily protein
Gene Symbol
Synonyms
MQL5.21; MQL5_21
Chromosome
5

Proteins

alpha/beta-Hydrolases superfamily protein
Refseq ID NP_199546
Protein GI 15238074
UniProt ID Q9LVS4
mRNA ID NM_124106
Length 316
RefSeq Status REVIEWED
MEKGLTMSCVLVVVAFLAMVHVSVSVPFVVFPEIGTQCSDAPNANFTQLLSNLSSSPGFCIEIGEGNPIGASWLIPLTQQAEVACDKVTQMEELSQGYNIVGRAQGSLVARGLIEFCEGGPPVHNYISLAGPHAGTADLLRCNTSGLICDIANGIGKENPYSDFVQDNLAPSGYFKNPKNVTGYLKDCQYLPKLNNERPYERNTTYKDRFASLQNLVFVLFENDTVIVPKESSWFGFYPDGDLTHVLPVQETKLYIEDWIGLKALVVAGKVQFVNVTGDHLIMADEDLVKYVVPLLQDQQSAPPRLNRKTKEPLHP

Gene Information

Entrez Gene ID
Gene Name
alpha/beta-Hydrolases superfamily protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008474 IEA:InterPro F palmitoyl-(protein) hydrolase activity
GO:0006464 IEA:InterPro P cellular protein modification process

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR002472 Palmitoyl protein thioesterase

UniProt Annotations

Entry Information

Gene Name
alpha/beta-Hydrolases superfamily protein
Protein Entry
Q9LVS4_ARATH
UniProt ID
Species
Arabidopsis

Identical and Related Proteins

Unique RefSeq proteins for LMP009833 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15238074 RefSeq NP_199546 316 alpha/beta-Hydrolases superfamily protein

Identical Sequences to LMP009833 proteins

Reference Database Accession Length Protein Name
GI:15238074 EMBL CAZ79154.1 316 unnamed protein product [Arabidopsis thaliana]
GI:15238074 GenBank AAM13072.1 316 unknown protein [Arabidopsis thaliana]
GI:15238074 GenBank AAM91172.1 316 unknown protein [Arabidopsis thaliana]
GI:15238074 GenBank ACH17588.1 316 Sequence 287 from patent US 7402667
GI:15238074 GenBank ADA48938.1 316 Sequence 30 from patent US 7622570
GI:15238074 gnl TAIR 316 alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]

Related Sequences to LMP009833 proteins

Reference Database Accession Length Protein Name
GI:15238074 GenBank AAM61704.1 316 palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana]
GI:15238074 GenBank EFH41382.1 313 palmitoyl protein thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15238074 GenBank EFH41383.1 316 palmitoyl protein thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15238074 RefSeq XP_002865123.1 313 palmitoyl protein thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15238074 RefSeq XP_002865124.1 316 palmitoyl protein thioesterase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15238074 RefSeq XP_002865126.1 314 hypothetical protein ARALYDRAFT_494249 [Arabidopsis lyrata subsp. lyrata]