Gene/Proteome Database (LMPD)
Proteins
alpha/beta-Hydrolases superfamily protein | |
---|---|
Refseq ID | NP_199546 |
Protein GI | 15238074 |
UniProt ID | Q9LVS4 |
mRNA ID | NM_124106 |
Length | 316 |
RefSeq Status | REVIEWED |
MEKGLTMSCVLVVVAFLAMVHVSVSVPFVVFPEIGTQCSDAPNANFTQLLSNLSSSPGFCIEIGEGNPIGASWLIPLTQQAEVACDKVTQMEELSQGYNIVGRAQGSLVARGLIEFCEGGPPVHNYISLAGPHAGTADLLRCNTSGLICDIANGIGKENPYSDFVQDNLAPSGYFKNPKNVTGYLKDCQYLPKLNNERPYERNTTYKDRFASLQNLVFVLFENDTVIVPKESSWFGFYPDGDLTHVLPVQETKLYIEDWIGLKALVVAGKVQFVNVTGDHLIMADEDLVKYVVPLLQDQQSAPPRLNRKTKEPLHP |
Gene Information
Entrez Gene ID
Gene Name
alpha/beta-Hydrolases superfamily protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008474 | IEA:InterPro | F | palmitoyl-(protein) hydrolase activity |
GO:0006464 | IEA:InterPro | P | cellular protein modification process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
alpha/beta-Hydrolases superfamily protein
Protein Entry
Q9LVS4_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP009833 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15238074 | RefSeq | NP_199546 | 316 | alpha/beta-Hydrolases superfamily protein |
Identical Sequences to LMP009833 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15238074 | EMBL | CAZ79154.1 | 316 | unnamed protein product [Arabidopsis thaliana] |
GI:15238074 | GenBank | AAM13072.1 | 316 | unknown protein [Arabidopsis thaliana] |
GI:15238074 | GenBank | AAM91172.1 | 316 | unknown protein [Arabidopsis thaliana] |
GI:15238074 | GenBank | ACH17588.1 | 316 | Sequence 287 from patent US 7402667 |
GI:15238074 | GenBank | ADA48938.1 | 316 | Sequence 30 from patent US 7622570 |
GI:15238074 | gnl | TAIR | 316 | alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana] |
Related Sequences to LMP009833 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15238074 | GenBank | AAM61704.1 | 316 | palmitoyl-protein thioesterase precursor-like [Arabidopsis thaliana] |
GI:15238074 | GenBank | EFH41382.1 | 313 | palmitoyl protein thioesterase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:15238074 | GenBank | EFH41383.1 | 316 | palmitoyl protein thioesterase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:15238074 | RefSeq | XP_002865123.1 | 313 | palmitoyl protein thioesterase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:15238074 | RefSeq | XP_002865124.1 | 316 | palmitoyl protein thioesterase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:15238074 | RefSeq | XP_002865126.1 | 314 | hypothetical protein ARALYDRAFT_494249 [Arabidopsis lyrata subsp. lyrata] |