Gene/Proteome Database (LMPD)

LMPD ID
LMP009840
Gene ID
828603
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
alpha-amylase 1
Gene Symbol
AMY1
Synonyms
alpha-amylase-like; AMY1; ATAMY1; F13M23.140; F13M23_140
Alternate Names
alpha-amylase 1
Chromosome
4
EC Number
3.2.1.1
Summary
Predicted to be secreted protein based on signalP prediction. Involved in starch mobilization. Mutants are defective in alpha-amylase activity. (Note: AMY1 has been found in the literature to be referred to as AMY3, which is not to be confused with AMY3/At1g69830).
Orthologs
View orthologs and multiple alignments for AMY1

Proteins

alpha-amylase 1
Refseq ID NP_567714
Protein GI 18416465
UniProt ID Q8VZ56
mRNA ID NM_118632
Length 423
RefSeq Status REVIEWED
MTSLHTLLFSSLLFFIVFPTFTFSSTLLFQSFNWESWKKEGGFYNSLHNSIDDIANAGITHLWLPPPSQSVAPEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKALADIVINHRTAERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFPGTGNLDTGGDFDGAPDIDHLNPRVQKELSEWMNWLKTEIGFHGWRFDYVRGYASSITKLYVQNTSPDFAVGEKWDDMKYGGDGKLDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKGELWRLKDSQGKPPGMIGIMPGNAVTFIDNHDTFRTWVFPSDKVLLGYVYILTHPGTPCIFYNHYIEWGLKESISKLVAIRNKNGIGSTSSVTIKAAEADLYLAMIDDKVIMKIGPKQDVGTLVPSNFALAYSGLDFAVWEKK

Gene Information

Entrez Gene ID
828603
Gene Name
alpha-amylase 1
Gene Symbol
AMY1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0048046 IDA:TAIR C apoplast
GO:0005576 TAS:TAIR C extracellular region
GO:0004556 IMP:TAIR F alpha-amylase activity
GO:0005509 IEA:InterPro F calcium ion binding
GO:0005975 IEA:UniProtKB-KW P carbohydrate metabolic process
GO:0009737 IEP:TAIR P response to abscisic acid
GO:0009739 IEP:TAIR P response to gibberellin

KEGG Pathway Links

KEGG Pathway ID Description
ath01100 Metabolic pathways
ath00500 Starch and sucrose metabolism

Domain Information

InterPro Annotations

Accession Description
IPR006046 Alpha amylase
IPR012850 Alpha-amylase, C-terminal beta-sheet
IPR013775 Alpha-amylase, plant
IPR017853 Glycoside hydrolase superfamily
IPR013781 Glycoside hydrolase, catalytic domain
IPR015902 Glycoside hydrolase, family 13
IPR013780 Glycosyl hydrolase, family 13, all-beta
IPR006047 Glycosyl hydrolase, family 13, catalytic domain

UniProt Annotations

Entry Information

Gene Name
alpha-amylase 1
Protein Entry
AMY1_ARATH
UniProt ID
Q8VZ56
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Endohydrolysis of (1->4)-alpha-D-glucosidic linkages in polysaccharides containing three or more (1->4)-alpha- linked D-glucose units.
Cofactor Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000250}; Note=Binds 3 Ca(2+) ions per subunit. {ECO:0000250};
Developmental Stage Up-regulated during leaf senescence.
Disruption Phenotype Early flowering. {ECO:0000269|PubMed:15637061}.
Function Possesses alpha-amylase activity in vitro, but seems not required for breakdown of transitory starch in leaves. {ECO:0000269|PubMed:17324226}.
Induction By gibberellin, abscisic acid (ABA), heat shock and infection with the bacterial pathogen P.syringae. Not regulated by transition from dark to light. {ECO:0000269|PubMed:15347792, ECO:0000269|PubMed:15927942, ECO:0000269|PubMed:17324226}.
Sequence Caution Sequence=CAB36742.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB79409.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the glycosyl hydrolase 13 family. {ECO:0000305}.
Subcellular Location Secreted, extracellular space, apoplast {ECO:0000305|PubMed:17324226}.
Subunit Monomer. {ECO:0000250}.
Tissue Specificity Expressed in leaves, stems, flowers and developing siliques. {ECO:0000269|PubMed:15927942}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009840 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18416465 RefSeq NP_567714 423 alpha-amylase 1

Identical Sequences to LMP009840 proteins

Reference Database Accession Length Protein Name
GI:18416465 GenBank AAL38709.1 423 putative alpha-amylase [Arabidopsis thaliana]
GI:18416465 GenBank AAM51369.1 423 putative alpha-amylase [Arabidopsis thaliana]
GI:18416465 GenBank AEE84990.1 423 alpha-amylase 1 [Arabidopsis thaliana]
GI:18416465 SwissProt Q8VZ56.1 423 RecName: Full=Alpha-amylase 1; Short=AtAMY1; AltName: Full=1,4-alpha-D-glucan glucanohydrolase; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009840 proteins

Reference Database Accession Length Protein Name
GI:18416465 EMBL CAB36742.1 428 alpha-amylase-like protein [Arabidopsis thaliana]
GI:18416465 EMBL CAB79409.1 428 alpha-amylase-like protein [Arabidopsis thaliana]
GI:18416465 GenBank AAM64582.1 423 alpha-amylase-like protein [Arabidopsis thaliana]
GI:18416465 GenBank EOA15522.1 422 hypothetical protein CARUB_v10004897mg [Capsella rubella]
GI:18416465 RefSeq XP_010438943.1 422 PREDICTED: alpha-amylase 1 [Camelina sativa]
GI:18416465 RefSeq XP_010448491.1 422 PREDICTED: alpha-amylase 1-like [Camelina sativa]