Gene/Proteome Database (LMPD)
LMPD ID
LMP009846
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
alpha-L-fucosidase 1
Gene Symbol
Synonyms
alpha-fucosidase 1; Arabidopsis thaliana alpha-fucosidase 1; ATFXG1; F12A21.4; F12A21_4; FXG1
Alternate Names
alpha-L-fucosidase 1
Chromosome
1
EC Number
3.2.1.51
Summary
Encodes a protein with α-fucosidase activity. The activity was assessed on 2'-fucosyl-lactitol. AtFXG1 was able to remove the t-fucosyl residues of XXFG xyloglucan oligosaccharides.
Orthologs
Proteins
alpha-L-fucosidase 1 | |
---|---|
Refseq ID | NP_176949 |
Protein GI | 15220550 |
UniProt ID | Q9FXE5 |
mRNA ID | NM_105451 |
Length | 372 |
RefSeq Status | REVIEWED |
MNPILSSLFALSLLSSLSPSTHAHQCHFPAIFNFGDSNSDTGGLSAAFGQAGPPHGSSFFGSPAGRYCDGRLVIDFIAESLGLPYLSAFLDSVGSNFSHGANFATAGSPIRALNSTLRQSGFSPFSLDVQFVQFYNFHNRSQTVRSRGGVYKTMLPESDSFSKALYTFDIGQNDLTAGYFANKTVEQVETEVPEIISQFMNAIKNIYGQGGRYFWIHNTGPIGCLAYVIERFPNKASDFDSHGCVSPLNHLAQQFNHALKQAVIELRSSLSEAAITYVDVYSLKHELFVHAQGHGFKGSLVSCCGHGGKYNYNKGIGCGMKKIVKGKEVYIGKPCDEPDKAVVWDGVHFTQAANKFIFDKIAPGLSKACKRQ |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0048046 | IEA:UniProtKB-KW | C | apoplast |
GO:0009505 | IDA:TAIR | C | plant-type cell wall |
GO:0004560 | IDA:TAIR | F | alpha-L-fucosidase activity |
GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001087 | Lipase, GDSL |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | An alpha-L-fucoside + H(2)O = L-fucose + an alcohol. |
Caution | The functional assignment is controversial. {ECO:0000305}. |
Function | Hydrolyzes alpha-1,2-linked fucose. Also active on fucosylated xyloglucan oligosaccharides. {ECO:0000269|PubMed:11788770}. |
Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
Subcellular Location | Secreted, extracellular space, apoplast {ECO:0000269|PubMed:11788770, ECO:0000269|PubMed:16267099}. |
Tissue Specificity | High expression in younger leaves and in the apical region of the inflorescence stem. {ECO:0000269|PubMed:16267099}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009846 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15220550 | RefSeq | NP_176949 | 372 | alpha-L-fucosidase 1 |
Identical Sequences to LMP009846 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15220550 | EMBL | CBC39275.1 | 372 | unnamed protein product [Arabidopsis thaliana] |
GI:15220550 | EMBL | CBC10253.1 | 372 | unnamed protein product [Arabidopsis thaliana] |
GI:15220550 | EMBL | CBC89570.1 | 372 | unnamed protein product [Arabidopsis thaliana] |
GI:15220550 | EMBL | CBC58439.1 | 372 | unnamed protein product [Arabidopsis thaliana] |
GI:15220550 | EMBL | CBD26054.1 | 372 | unnamed protein product [Arabidopsis thaliana] |
GI:15220550 | GenBank | AEE34703.1 | 372 | alpha-L-fucosidase 3 [Arabidopsis thaliana] |
Related Sequences to LMP009846 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15220550 | EMBL | CAW70170.1 | 365 | unnamed protein product [Arabidopsis thaliana] |
GI:15220550 | EMBL | CAW60558.1 | 365 | unnamed protein product [Arabidopsis thaliana] |
GI:15220550 | EMBL | CAW44959.1 | 365 | unnamed protein product [Arabidopsis thaliana] |
GI:15220550 | EMBL | CAW87289.1 | 365 | unnamed protein product [Arabidopsis thaliana] |
GI:15220550 | EMBL | CBC26155.1 | 365 | unnamed protein product [Arabidopsis thaliana] |
GI:15220550 | EMBL | CBC39683.1 | 365 | unnamed protein product [Arabidopsis thaliana] |