Gene/Proteome Database (LMPD)

LMPD ID
LMP009846
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
alpha-L-fucosidase 1
Gene Symbol
Synonyms
alpha-fucosidase 1; Arabidopsis thaliana alpha-fucosidase 1; ATFXG1; F12A21.4; F12A21_4; FXG1
Alternate Names
alpha-L-fucosidase 1
Chromosome
1
EC Number
3.2.1.51
Summary
Encodes a protein with α-fucosidase activity. The activity was assessed on 2'-fucosyl-lactitol. AtFXG1 was able to remove the t-fucosyl residues of XXFG xyloglucan oligosaccharides.
Orthologs

Proteins

alpha-L-fucosidase 1
Refseq ID NP_176949
Protein GI 15220550
UniProt ID Q9FXE5
mRNA ID NM_105451
Length 372
RefSeq Status REVIEWED
MNPILSSLFALSLLSSLSPSTHAHQCHFPAIFNFGDSNSDTGGLSAAFGQAGPPHGSSFFGSPAGRYCDGRLVIDFIAESLGLPYLSAFLDSVGSNFSHGANFATAGSPIRALNSTLRQSGFSPFSLDVQFVQFYNFHNRSQTVRSRGGVYKTMLPESDSFSKALYTFDIGQNDLTAGYFANKTVEQVETEVPEIISQFMNAIKNIYGQGGRYFWIHNTGPIGCLAYVIERFPNKASDFDSHGCVSPLNHLAQQFNHALKQAVIELRSSLSEAAITYVDVYSLKHELFVHAQGHGFKGSLVSCCGHGGKYNYNKGIGCGMKKIVKGKEVYIGKPCDEPDKAVVWDGVHFTQAANKFIFDKIAPGLSKACKRQ

Gene Information

Entrez Gene ID
Gene Name
alpha-L-fucosidase 1
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0048046 IEA:UniProtKB-KW C apoplast
GO:0009505 IDA:TAIR C plant-type cell wall
GO:0004560 IDA:TAIR F alpha-L-fucosidase activity
GO:0016788 IEA:InterPro F hydrolase activity, acting on ester bonds
GO:0006629 IEA:InterPro P lipid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00511 Other glycan degradation
ko00511 Other glycan degradation

Domain Information

InterPro Annotations

Accession Description
IPR001087 Lipase, GDSL

UniProt Annotations

Entry Information

Gene Name
alpha-L-fucosidase 1
Protein Entry
FUCO3_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity An alpha-L-fucoside + H(2)O = L-fucose + an alcohol.
Caution The functional assignment is controversial. {ECO:0000305}.
Function Hydrolyzes alpha-1,2-linked fucose. Also active on fucosylated xyloglucan oligosaccharides. {ECO:0000269|PubMed:11788770}.
Similarity Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}.
Subcellular Location Secreted, extracellular space, apoplast {ECO:0000269|PubMed:11788770, ECO:0000269|PubMed:16267099}.
Tissue Specificity High expression in younger leaves and in the apical region of the inflorescence stem. {ECO:0000269|PubMed:16267099}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009846 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15220550 RefSeq NP_176949 372 alpha-L-fucosidase 1

Identical Sequences to LMP009846 proteins

Reference Database Accession Length Protein Name
GI:15220550 EMBL CBC39275.1 372 unnamed protein product [Arabidopsis thaliana]
GI:15220550 EMBL CBC10253.1 372 unnamed protein product [Arabidopsis thaliana]
GI:15220550 EMBL CBC89570.1 372 unnamed protein product [Arabidopsis thaliana]
GI:15220550 EMBL CBC58439.1 372 unnamed protein product [Arabidopsis thaliana]
GI:15220550 EMBL CBD26054.1 372 unnamed protein product [Arabidopsis thaliana]
GI:15220550 GenBank AEE34703.1 372 alpha-L-fucosidase 3 [Arabidopsis thaliana]

Related Sequences to LMP009846 proteins

Reference Database Accession Length Protein Name
GI:15220550 EMBL CAW70170.1 365 unnamed protein product [Arabidopsis thaliana]
GI:15220550 EMBL CAW60558.1 365 unnamed protein product [Arabidopsis thaliana]
GI:15220550 EMBL CAW44959.1 365 unnamed protein product [Arabidopsis thaliana]
GI:15220550 EMBL CAW87289.1 365 unnamed protein product [Arabidopsis thaliana]
GI:15220550 EMBL CBC26155.1 365 unnamed protein product [Arabidopsis thaliana]
GI:15220550 EMBL CBC39683.1 365 unnamed protein product [Arabidopsis thaliana]