Gene/Proteome Database (LMPD)

LMPD ID
LMP009875
Gene ID
837740
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
aspartic proteinase A1
Gene Symbol
APA1
Synonyms
aspartic proteinase A1; ATAPA1; F12F1.24; F12F1_24
Alternate Names
aspartic proteinase A1
Chromosome
1
EC Number
3.4.23.-
Summary
Encodes an aspartic proteinase that forms a heterodimer and is stable over a broad pH range (ph 3-8).
Orthologs
View orthologs and multiple alignments for APA1

Proteins

aspartic proteinase A1
Refseq ID NP_172655
Protein GI 15221141
UniProt ID O65390
mRNA ID NM_101062
Length 506
RefSeq Status REVIEWED
MKIYSRTVAVSLIVSFLLCFSAFAERNDGTFRVGLKKLKLDSKNRLAARVESKQEKPLRAYRLGDSGDADVVVLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPKYKSSRSSTYEKNGKAAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVVAKFDGILGLGFQEISVGKAAPVWYNMLKQGLIKEPVFSFWLNRNADEEEGGELVFGGVDPNHFKGKHTYVPVTQKGYWQFDMGDVLIGGAPTGFCESGCSAIADSGTSLLAGPTTIITMINHAIGAAGVVSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEAA

Gene Information

Entrez Gene ID
837740
Gene Name
aspartic proteinase A1
Gene Symbol
APA1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:TAIR C cytosol
GO:0009506 IDA:TAIR C plasmodesma
GO:0005773 IDA:TAIR C vacuole
GO:0004190 IEA:UniProtKB-KW F aspartic-type endopeptidase activity
GO:0004175 IDA:TAIR F endopeptidase activity
GO:0006629 IEA:InterPro P lipid metabolic process
GO:0006508 IDA:TAIR P proteolysis
GO:0009735 IDA:TAIR P response to cytokinin
GO:0009651 IEP:TAIR P response to salt stress

REACTOME Pathway Links

REACTOME Pathway ID Description
6253768 Adaptive Immune System
6253763 Immune System
6254362 MHC class II antigen presentation

Domain Information

InterPro Annotations

Accession Description
IPR001461 Aspartic peptidase
IPR021109 Aspartic peptidase domain
IPR001969 Aspartic peptidase, active site
IPR008139 Saposin B
IPR011001 Saposin-like
IPR007856 Saposin-like type B, 1
IPR008138 Saposin-like type B, 2

UniProt Annotations

Entry Information

Gene Name
aspartic proteinase A1
Protein Entry
APA1_ARATH
UniProt ID
O65390
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties pH dependence: Optimum pH is 5.0-6.0 with insulin B chain as substrate and at 37 degrees Celsius. {ECO:0000269|PubMed:20079503};
Function Involved in the breakdown of propeptides of storage proteins in protein-storage vacuoles (By similarity). Possesses aspartic protease activity in vitro. {ECO:0000250, ECO:0000269|PubMed:20079503}.
Induction By light and during senescence. {ECO:0000269|PubMed:12230581, ECO:0000269|PubMed:12947053}.
Similarity Belongs to the peptidase A1 family. {ECO:0000305}.
Similarity Contains 1 saposin B-type domain. {ECO:0000255|PROSITE-ProRule:PRU00415}.
Subcellular Location Vacuole {ECO:0000269|PubMed:17012602}. Note=Located in protein storage vacuoles (PSV) of the embryo.
Tissue Specificity Expressed in roots, leaves, stems, petals, carpels, seed pods and dry seeds. {ECO:0000269|PubMed:12230581}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009875 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15221141 RefSeq NP_172655 506 aspartic proteinase A1

Identical Sequences to LMP009875 proteins

Reference Database Accession Length Protein Name
GI:15221141 GenBank AAL36330.1 506 putative aspartic proteinase [Arabidopsis thaliana]
GI:15221141 GenBank AAM66979.1 506 putative aspartic proteinase [Arabidopsis thaliana]
GI:15221141 GenBank AAN71979.1 506 putative aspartic proteinase [Arabidopsis thaliana]
GI:15221141 GenBank ADA48935.1 506 Sequence 24 from patent US 7622570
GI:15221141 GenBank AEE28813.1 506 aspartic proteinase A1 [Arabidopsis thaliana]
GI:15221141 SwissProt O65390.1 506 RecName: Full=Aspartic proteinase A1; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP009875 proteins

Reference Database Accession Length Protein Name
GI:15221141 GenBank AAC49730.1 486 aspartic proteinase, partial [Arabidopsis thaliana]
GI:15221141 GenBank EFH68920.1 506 aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
GI:15221141 RefSeq XP_002892661.1 506 aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
GI:15221141 RefSeq XP_010458606.1 506 PREDICTED: aspartic proteinase A1 [Camelina sativa]
GI:15221141 RefSeq XP_010458607.1 506 PREDICTED: aspartic proteinase A1 [Camelina sativa]
GI:15221141 RefSeq XP_010476135.1 506 PREDICTED: aspartic proteinase A1-like [Camelina sativa]