Gene/Proteome Database (LMPD)
Proteins
BAX inhibitor 1 | |
---|---|
Refseq ID | NP_199523 |
Protein GI | 15238017 |
UniProt ID | Q9LD45 |
mRNA ID | NM_124083 |
Length | 247 |
RefSeq Status | REVIEWED |
MDAFSSFFDSQPGSRSWSYDSLKNFRQISPAVQNHLKRVYLTLCCALVASAFGAYLHVLWNIGGILTTIGCIGTMIWLLSCPPYEHQKRLSLLFVSAVLEGASVGPLIKVAIDVDPSILITAFVGTAIAFVCFSAAAMLARRREYLYLGGLLSSGLSMLMWLQFASSIFGGSASIFKFELYFGLLIFVGYMVVDTQEIIEKAHLGDMDYVKHSLTLFTDFVAVFVRILIIMLKNSADKEEKKKKRRN |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IDA:TAIR | C | cytoplasm |
GO:0005783 | IDA:TAIR | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005635 | IDA:TAIR | C | nuclear envelope |
GO:0006915 | IEA:UniProtKB-KW | P | apoptotic process |
GO:0006983 | IMP:TAIR | P | ER overload response |
GO:0043066 | IEA:InterPro | P | negative regulation of apoptotic process |
GO:0043069 | IMP:TAIR | P | negative regulation of programmed cell death |
GO:0009414 | IEP:TAIR | P | response to water deprivation |
GO:0000038 | IMP:TAIR | P | very long-chain fatty acid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Disruption Phenotype | No visible phenotype under normal growth conditions. Accelerated methyl jasmonate-induced leaf senescence. Enhanced sensitivity to water stress, heat shock, toxin, tunicamycin and pathogens. {ECO:0000269|PubMed:16507080, ECO:0000269|PubMed:18039663, ECO:0000269|PubMed:19674971, ECO:0000269|PubMed:20298483, ECO:0000269|PubMed:22563118}. |
Function | Suppressor of apoptosis. Modulator of endoplasmic reticulum stress-mediated programmed cell death. Involved in methyl jasmonate-induced leaf senescence through regulating cytoplasmic calcium level. {ECO:0000269|PubMed:16507080, ECO:0000269|PubMed:18039663, ECO:0000269|PubMed:22563118}. |
Induction | Up-regulated by water stress, heat-shock, mycotoxin and pathogens. {ECO:0000269|PubMed:16507080, ECO:0000269|PubMed:19674971, ECO:0000269|PubMed:20298483}. |
Interaction | P59220:CAM7; NbExp=2; IntAct=EBI-1644586, EBI-1236031; O48845:CYTB5-B; NbExp=5; IntAct=EBI-1644586, EBI-2295402; |
Similarity | Belongs to the BI1 family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:19054355}; Multi-pass membrane protein {ECO:0000269|PubMed:19054355}. |
Subunit | Interacts (via C-terminus) with calmodulin, CYTB5-B and CYTB5-D. Interacts indirectly with FAH1 via CYTB5-D. {ECO:0000269|PubMed:17142482, ECO:0000269|PubMed:19054355, ECO:0000269|PubMed:19674971, ECO:0000269|PubMed:22635113}. |
Tissue Specificity | Expressed in root tips, root vasculature, flower tissues, including stamens and sepals, and in the base of siliques. Not detected in mature leaves. {ECO:0000269|PubMed:19674971}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP009899 (as displayed in Record Overview)
Identical Sequences to LMP009899 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15238017 | GenBank | AGF25160.1 | 247 | Sequence 4 from patent US 8373022 |
GI:15238017 | GenBank | AGX79574.1 | 247 | Sequence 58913 from patent US 8541208 |
GI:15238017 | GenBank | AGX95329.1 | 247 | Sequence 70919 from patent US 8541208 |
GI:15238017 | GenBank | AGX97702.1 | 247 | Sequence 75652 from patent US 8541208 |
GI:15238017 | GenBank | AGY03412.1 | 247 | Sequence 87023 from patent US 8541208 |
GI:15238017 | GenBank | AGY09760.1 | 247 | Sequence 99621 from patent US 8541208 |
Related Sequences to LMP009899 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15238017 | EMBL | CBG18110.1 | 247 | unnamed protein product [Arabidopsis thaliana] |
GI:15238017 | EMBL | CBG03941.1 | 247 | unnamed protein product [Arabidopsis thaliana] |
GI:15238017 | GenBank | AGX95324.1 | 247 | Sequence 70909 from patent US 8541208 |
GI:15238017 | GenBank | AGX97697.1 | 247 | Sequence 75642 from patent US 8541208 |
GI:15238017 | GenBank | AGY03407.1 | 247 | Sequence 87013 from patent US 8541208 |
GI:15238017 | GenBank | AGY09755.1 | 247 | Sequence 99611 from patent US 8541208 |