Gene/Proteome Database (LMPD)
Proteins
Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | |
---|---|
Refseq ID | NP_850800 |
Protein GI | 30682659 |
UniProt ID | Q9FY78 |
mRNA ID | NM_180469 |
Length | 158 |
RefSeq Status | REVIEWED |
MAYFSTATSLLLLVLSVSSPYVHGASDCDTLVITLFPCLPFISIGGTADTPTASCCSSLKNILDTKPICLCEGLKKAPLGIKLNVTKSATLPVACKLNAPPVSACDSLPPASPPTANGQAPVWGSGWAPAPSPSKGNSLIPISGFSFVIVTALAMFRI |
Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | |
---|---|
Refseq ID | NP_568210 |
Protein GI | 18415958 |
UniProt ID | Q8LD67 |
mRNA ID | NM_120973 |
Length | 129 |
RefSeq Status | REVIEWED |
MAYFSTATSLLLLVLSVSSPYVHGASDCDTLVITLFPCLPFISIGGTADTPTASCCSSLKNILDTKPICLCEGLKKAPLGIKLNVTKSATLPVACKLNAPPVSACDSLPPASPPTANGQGKWNLFGLFA |
Gene Information
Entrez Gene ID
Gene Name
Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008289 | IEA:InterPro | F | lipid binding |
GO:0006869 | IEA:InterPro | P | lipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Protein Entry
Q8LD67_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP009914 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
30682659 | RefSeq | NP_850800 | 158 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein |
18415958 | RefSeq | NP_568210 | 129 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein |
Identical Sequences to LMP009914 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30682659 | DBBJ | BAC43083.1 | 158 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:30682659 | DBBJ | BAE73260.1 | 158 | xylogen like protein 4 [Arabidopsis thaliana] |
GI:30682659 | EMBL | CAC05463.1 | 158 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:18415958 | GenBank | AAM63379.1 | 129 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:18415958 | gnl | TAIR | 129 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
GI:30682659 | gnl | TAIR | 158 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
Related Sequences to LMP009914 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18415958 | DBBJ | BAC43083.1 | 158 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:18415958 | DBBJ | BAE73260.1 | 158 | xylogen like protein 4 [Arabidopsis thaliana] |
GI:18415958 | EMBL | CAC05463.1 | 158 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:30682659 | GenBank | AAM63379.1 | 129 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:30682659 | GenBank | EFH52407.1 | 133 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
GI:30682659 | gnl | TAIR | 129 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
GI:18415958 | gnl | TAIR | 158 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
GI:30682659 | RefSeq | NP_568210.1 | 129 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
GI:18415958 | RefSeq | NP_850800.1 | 158 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
GI:30682659 | RefSeq | XP_002876148.1 | 133 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
GI:18415958 | RefSeq | XP_002876148.1 | 133 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
GI:30682659 | RefSeq | XP_006288777.1 | 173 | hypothetical protein CARUB_v10002098mg [Capsella rubella] |