Gene/Proteome Database (LMPD)
Proteins
| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | |
|---|---|
| Refseq ID | NP_001119032 |
| Protein GI | 186512496 |
| UniProt ID | B3H5X1 |
| mRNA ID | NM_001125560 |
| Length | 159 |
| RefSeq Status | REVIEWED |
| MAYTNQISAVVFLAVAIAPLLAEPQSTMFPEMTPECATVMPDLLEKCFATGSVTPTEDCCTDLKSATSTQVTCLCDNYIANPAVSNITGPYSKAITTKCGVFDKYSCDGTSKGEEKKGGSSSSNGKDNGKSEGNGGRANSVAASMAMFGLLASLVFVMF | |
| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | |
|---|---|
| Refseq ID | NP_001031699 |
| Protein GI | 79325229 |
| UniProt ID | Q1G3I0 |
| mRNA ID | NM_001036622 |
| Length | 160 |
| RefSeq Status | REVIEWED |
| MAYTNQISAVVFLAVAIAPLLAEPQSTMFPEMTPECATVMPDLLEKCFATGSVTPTEDCCTDLKSATSTQVTCLCDNYIANPAVSNITGPYSKAITTKCGVFDKYSCDGTSKGGEEKKGGSSSSNGKDNGKSEGNGGRANSVAASMAMFGLLASLVFVMF | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016140 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain |
UniProt Annotations
Entry Information
Gene Name
Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Protein Entry
Q1G3I0_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP009932 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 79325229 | RefSeq | NP_001031699 | 160 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein |
| 186512496 | RefSeq | NP_001119032 | 159 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein |
Identical Sequences to LMP009932 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:79325229 | GenBank | ABF59247.1 | 160 | unknown protein [Arabidopsis thaliana] |
| GI:79325229 | GenBank | AEE84636.1 | 160 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:186512496 | GenBank | AEE84637.1 | 159 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
Related Sequences to LMP009932 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:186512496 | GenBank | ABF59247.1 | 160 | unknown protein [Arabidopsis thaliana] |
| GI:79325229 | GenBank | EFH46073.1 | 177 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:186512496 | GenBank | EFH46074.1 | 160 | hypothetical protein ARALYDRAFT_492604 [Arabidopsis lyrata subsp. lyrata] |
| GI:79325229 | GenBank | EFH46074.1 | 160 | hypothetical protein ARALYDRAFT_492604 [Arabidopsis lyrata subsp. lyrata] |
| GI:186512496 | GenBank | AEE84636.1 | 160 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:79325229 | GenBank | AEE84637.1 | 159 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:186512496 | RefSeq | NP_001031699.1 | 160 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:79325229 | RefSeq | NP_001119032.1 | 159 | Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:79325229 | RefSeq | XP_002869814.1 | 177 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:186512496 | RefSeq | XP_002869814.1 | 177 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:186512496 | RefSeq | XP_002869815.1 | 160 | hypothetical protein ARALYDRAFT_492604 [Arabidopsis lyrata subsp. lyrata] |
| GI:79325229 | RefSeq | XP_002869815.1 | 160 | hypothetical protein ARALYDRAFT_492604 [Arabidopsis lyrata subsp. lyrata] |