Gene/Proteome Database (LMPD)
Proteins
| bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein | |
|---|---|
| Refseq ID | NP_566713 |
| Protein GI | 18403457 |
| UniProt ID | Q9LJ85 |
| mRNA ID | NM_113160 |
| Length | 203 |
| RefSeq Status | REVIEWED |
| MSKIISLVVAMIAVLALPIRGQQQPLSQCTPSMMTTVSPCMGFITNSSSNGTSPSSDCCNSLRSLTTGGMGCLCLIVTGTVPFNIPINRTTAVSLPRACNMPRVPLQCQANIAPAAAPGPAATFGPSMSPGPETDPIVPEPTPAAQTPQSDTTRPFTPSVDGGAPTSDDGGSTSRPSETPSSAYALSPSLLFFSIALVALKFY | |
Gene Information
Entrez Gene ID
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009941 | IDA:TAIR | C | chloroplast envelope |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016140 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain |
UniProt Annotations
Entry Information
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein
Protein Entry
Q9LJ85_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP009936 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18403457 | RefSeq | NP_566713 | 203 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein |
Identical Sequences to LMP009936 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18403457 | DBBJ | BAB01476.1 | 203 | unnamed protein product [Arabidopsis thaliana] |
| GI:18403457 | GenBank | AAK59510.1 | 203 | unknown protein [Arabidopsis thaliana] |
| GI:18403457 | GenBank | AAM44945.1 | 203 | unknown protein [Arabidopsis thaliana] |
| GI:18403457 | GenBank | AEE76658.1 | 203 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin-like protein [Arabidopsis thaliana] |
Related Sequences to LMP009936 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18403457 | GenBank | EFH59632.1 | 203 | protease inhibitor/seed storage/lipid transfer protein family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18403457 | GenBank | EOA32748.1 | 203 | hypothetical protein CARUB_v10016053mg [Capsella rubella] |
| GI:18403457 | RefSeq | XP_006299850.1 | 203 | hypothetical protein CARUB_v10016053mg [Capsella rubella] |
| GI:18403457 | RefSeq | XP_010511526.1 | 203 | PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Camelina sativa] |
| GI:18403457 | RefSeq | XP_010466547.1 | 203 | PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Camelina sativa] |
| GI:18403457 | RefSeq | XP_010488294.1 | 203 | PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Camelina sativa] |