Gene/Proteome Database (LMPD)

LMPD ID
LMP009955
Gene ID
825291
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
BON association protein 1
Gene Symbol
BAP1
Synonyms
BON association protein 1
Chromosome
3
Summary
Encodes a protein with a C2 domain that binds to BON1 in yeast two hybrid analyses. Its ability to bind to phospholipids is enhanced by calcium ions. Involved in maintaining cell homeostasis.
Orthologs
View orthologs and multiple alignments for BAP1

Proteins

BON association protein 1
Refseq ID NP_567111
Protein GI 18411880
UniProt ID Q941L2
mRNA ID NM_115983
Length 192
RefSeq Status REVIEWED
MIYFGRSIDNHYTTMMTKTLEIDLRSAEGLKLNRRPIKKKTFAVVKIDEKCRKSNLDESRRSNPTWNYKSEMPINGNEQFIFIEVFYRTGSGHDKKIGEAKIPTNDFMGRYSPEGHLNFLSYRLRDEFGDKCGIVNLSILVKSDPTRDYGACSSQAAVTGLWRPRLETASIDGYGGRTVTGVPVWGLYQRQF
BON association protein 1
Refseq ID NP_001190150
Protein GI 334186178
UniProt ID Q941L2
mRNA ID NM_001203221
Length 178
RefSeq Status REVIEWED
MMTKTLEIDLRSAEGLKLNRRPIKKKTFAVVKIDEKCRKSNLDESRRSNPTWNYKSEMPINGNEQFIFIEVFYRTGSGHDKKIGEAKIPTNDFMGRYSPEGHLNFLSYRLRDEFGDKCGIVNLSILVKSDPTRDYGACSSQAAVTGLWRPRLETASIDGYGGRTVTGVPVWGLYQRQF

Gene Information

Entrez Gene ID
825291
Gene Name
BON association protein 1
Gene Symbol
BAP1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016020 IDA:TAIR C membrane
GO:0005543 IDA:TAIR F phospholipid binding
GO:0019725 IPI:TAIR P cellular homeostasis
GO:0006952 IEA:UniProtKB-KW P defense response
GO:0031348 IMP:TAIR P negative regulation of defense response
GO:0009409 IEP:TAIR P response to cold
GO:0009408 IEP:TAIR P response to heat
GO:0009751 IEP:TAIR P response to salicylic acid
GO:0009266 IEP:TAIR P response to temperature stimulus
GO:0009611 IEP:TAIR P response to wounding

Domain Information

InterPro Annotations

Accession Description
IPR000008 C2 domain

UniProt Annotations

Entry Information

Gene Name
BON association protein 1
Protein Entry
BAP1_ARATH
UniProt ID
Q941L2
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced. According to EST sequences.; Name=1; IsoId=Q941L2-1; Sequence=Displayed;
Disruption Phenotype Dwarf, twisted leaves and enhanced disease resistance to bacterial and oomycete pathogens in cv. Columbia when grown under constant loght at 22 degrees Celsius. No visible phenotype when grown at 28 degrees Celsius. Accelerated hypersensitive response (HR). Bap1 and bap2 double mutant is seedling lethal. {ECO:0000269|PubMed:17018034, ECO:0000269|PubMed:17631528}.
Function Negative regulator of cell death and defense responses. Exhibits calcium-dependent phospholipid binding properties. {ECO:0000269|PubMed:17018034, ECO:0000269|PubMed:17631528}.
Induction Down-regulated by high temperature. Up-regulated by salicylic acid, AgNO(3), chitin, cycloheximide, ozone, syringolin, salt stress and upon pathogen or nematode infection. {ECO:0000269|PubMed:11544183, ECO:0000269|PubMed:17018034, ECO:0000269|PubMed:17631528}.
Interaction Q5S1W2:BON2; NbExp=3; IntAct=EBI-1606302, EBI-1606334;
Miscellaneous Overexpression of BAP1 can suppress a defect in BON1 and confers more susceptibility to virulent pathogens.
Sequence Caution Sequence=AAM64568.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=CAB71049.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Similarity Contains 1 C2 domain. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000269|PubMed:17018034}; Peripheral membrane protein {ECO:0000269|PubMed:17018034}.
Subunit Interacts with BON1 (via VWA domain), BON2 and BON3. {ECO:0000269|PubMed:11544183, ECO:0000269|PubMed:17018034, ECO:0000269|PubMed:17631528, ECO:0000269|PubMed:20634289}.
Tissue Specificity Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:11544183}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009955 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18411880 RefSeq NP_567111 192 BON association protein 1
334186178 RefSeq NP_001190150 178 BON association protein 1

Identical Sequences to LMP009955 proteins

Reference Database Accession Length Protein Name
GI:18411880 DBBJ BAC41910.1 192 putative BON1-associated protein 1 BAP1 [Arabidopsis thaliana]
GI:334186178 EMBL CAB71049.1 178 putative protein [Arabidopsis thaliana]
GI:18411880 EMBL CAD28389.1 192 unnamed protein product [Arabidopsis thaliana]
GI:18411880 GenBank AAK98798.1 192 BON1-associated protein 1 [Arabidopsis thaliana]
GI:18411880 GenBank AAO39955.1 192 At3g61190 [Arabidopsis thaliana]
GI:18411880 GenBank AEE80170.1 192 BON association protein 1 [Arabidopsis thaliana]
GI:334186178 GenBank AEE80171.1 178 BON association protein 1 [Arabidopsis thaliana]
GI:18411880 SwissProt Q941L2.1 192 RecName: Full=BON1-associated protein 1 [Arabidopsis thaliana]

Related Sequences to LMP009955 proteins

Reference Database Accession Length Protein Name
GI:334186178 DBBJ BAC41910.1 192 putative BON1-associated protein 1 BAP1 [Arabidopsis thaliana]
GI:18411880 EMBL CAB71049.1 178 putative protein [Arabidopsis thaliana]
GI:334186178 EMBL CAD28389.1 192 unnamed protein product [Arabidopsis thaliana]
GI:334186178 GenBank AAK98798.1 192 BON1-associated protein 1 [Arabidopsis thaliana]
GI:18411880 GenBank AAM64568.1 177 unknown [Arabidopsis thaliana]
GI:334186178 GenBank AAO39955.1 192 At3g61190 [Arabidopsis thaliana]
GI:18411880 GenBank EFH54628.1 179 hypothetical protein ARALYDRAFT_486595 [Arabidopsis lyrata subsp. lyrata]
GI:334186178 GenBank AEE80170.1 192 BON association protein 1 [Arabidopsis thaliana]
GI:18411880 GenBank AEE80171.1 178 BON association protein 1 [Arabidopsis thaliana]
GI:334186178 RefSeq NP_567111.1 192 BON association protein 1 [Arabidopsis thaliana]
GI:18411880 RefSeq XP_002878369.1 179 hypothetical protein ARALYDRAFT_486595 [Arabidopsis lyrata subsp. lyrata]
GI:18411880 RefSeq NP_001190150.1 178 BON association protein 1 [Arabidopsis thaliana]