Gene/Proteome Database (LMPD)

LMPD ID
LMP009974
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Gene Symbol
Synonyms
HYDRA1
Alternate Names
probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Chromosome
1
EC Number
5.3.3.5
Summary
C-8 sterol isomerase
Orthologs

Proteins

probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Refseq ID NP_173433
Protein GI 15223758
UniProt ID Q0WRA8
mRNA ID NM_101859
Length 223
RefSeq Status REVIEWED
MEELAHPYVPRDLNLPGYVPISMSMSSIVSIYLGSSLLVVSLVWLLFGRKKAKLDKLLMCWWTFTGLTHVILEGYFVFSPEFFKDNTSAYLAEVWKEYSKGDSRYVGRDSAVVSVEGITAVIVGPASLLAIYAIAKEKSYSYVLQLAISVCQLYGCLVYFITAILEGDNFATNSFYYYSYYIGANCWWVLIPSLISFRCWKKICAAAAIANNNVETKTKKKTR

Gene Information

Entrez Gene ID
Gene Name
probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IDA:TAIR C plasma membrane
GO:0000247 IMP:TAIR F C-8 sterol isomerase activity
GO:0047750 IEA:UniProtKB-EC F cholestenol delta-isomerase activity
GO:0060964 IMP:TAIR P regulation of gene silencing by miRNA
GO:0016126 TAS:TAIR P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01110 Biosynthesis of secondary metabolites
ath01100 Metabolic pathways
ath00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6254036 Cholesterol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR007905 Emopamil-binding protein

UniProt Annotations

Entry Information

Gene Name
probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Protein Entry
EBP_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity 5-alpha-cholest-7-en-3-beta-ol = 5-alpha- cholest-8-en-3-beta-ol.
Function Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers. {ECO:0000250}.
Pathway Steroid biosynthesis; sterol biosynthesis.
Similarity Belongs to the EBP family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP009974 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15223758 RefSeq NP_173433 223 probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase

Identical Sequences to LMP009974 proteins

Reference Database Accession Length Protein Name
GI:15223758 GenBank ACW93529.1 223 Sequence 12418 from patent US 7569389
GI:15223758 GenBank ACW94001.1 223 Sequence 13057 from patent US 7569389
GI:15223758 GenBank ACX05444.1 223 Sequence 28633 from patent US 7569389
GI:15223758 GenBank ACX16624.1 223 Sequence 43815 from patent US 7569389
GI:15223758 GenBank ACX21375.1 223 Sequence 50236 from patent US 7569389
GI:15223758 GenBank AEE29928.1 223 probable 3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase [Arabidopsis thaliana]

Related Sequences to LMP009974 proteins

Reference Database Accession Length Protein Name
GI:15223758 GenBank AAD04752.1 223 phenylalkylamine binding protein homolog [Arabidopsis thaliana]
GI:15223758 GenBank ACW94197.1 223 Sequence 13322 from patent US 7569389
GI:15223758 GenBank ACX08060.1 223 Sequence 32180 from patent US 7569389
GI:15223758 GenBank ACX18545.1 223 Sequence 46414 from patent US 7569389
GI:15223758 GenBank AEL84744.1 223 Sequence 90 from patent US 7989676
GI:15223758 GenBank AGF14090.1 223 Sequence 13509 from patent US 8362325