Gene/Proteome Database (LMPD)

LMPD ID
LMP010039
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphorylcholine cytidylyltransferase2
Gene Symbol
Synonyms
ATCCT2; CCT2; DL3610W; FCAALL.209; phosphorylcholine cytidylyltransferase2
Alternate Names
phosphorylcholine cytidylyltransferase2
Chromosome
4
EC Number
2.7.7.15

Proteins

phosphorylcholine cytidylyltransferase2
Refseq ID NP_193249
Protein GI 240255851
UniProt ID F4JJE0
mRNA ID NM_117602
Length 304
RefSeq Status REVIEWED
MSVNGENKVSGGDSSSSDRPVRVYADGIFDLFHFGHARAIEQAKKSFPNTYLLVGCCNDEITNKFKGKTVMTESERYESLRHCKWVDEVIPDAPWVLTTEFLDKHKIDYVAHDALPYADTSGAGNDVYEFVKSIGKFKETKRTEGISTSDIIMRIVKDYNQYVLRNLDRGYSREELGVSFEEKRLRVNMRLKKLQEKVKEQQEKIQTVAKTAGMHHDEWLENADRWVAGFLEMFEEGCHKMGTAIRDGIQQRLMRQESEENRRLLQNGLTISKDNDDEQMSDDNEFAEEDCVNVSNKGIETVKK

Gene Information

Entrez Gene ID
Gene Name
phosphorylcholine cytidylyltransferase2
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0004105 IMP:TAIR F choline-phosphate cytidylyltransferase activity
GO:0006657 IMP:GOC P CDP-choline pathway
GO:0006656 IMP:TAIR P phosphatidylcholine biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00564 Glycerophospholipid metabolism
ath01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
6253801 Glycerophospholipid biosynthesis
6254221 Synthesis of PC

Domain Information

InterPro Annotations

Accession Description
IPR004821 Cytidyltransferase-like domain
IPR014729 Rossmann-like alpha/beta/alpha sandwich fold

UniProt Annotations

Entry Information

Gene Name
phosphorylcholine cytidylyltransferase2
Protein Entry
CCT2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Temperature dependence: Optimum temperature is 30 degrees Celsius. {ECO:0000269|PubMed:12461134};
Catalytic Activity CTP + phosphocholine = diphosphate + CDP- choline.
Disruption Phenotype No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:19667100}.
Function Plays an important role in the biosynthesis of the phospholipid phosphatidylcholine. Catalyzes the formation of CDP- choline. {ECO:0000269|PubMed:19667100}.
Induction By cold treatment. {ECO:0000269|PubMed:12461134}.
Pathway Phospholipid metabolism; phosphatidylcholine biosynthesis; phosphatidylcholine from phosphocholine: step 1/2.
Sequence Caution Sequence=CAB45996.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB78555.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the cytidylyltransferase family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010039 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
240255851 RefSeq NP_193249 304 phosphorylcholine cytidylyltransferase2

Identical Sequences to LMP010039 proteins

Reference Database Accession Length Protein Name
GI:240255851 GenBank AEE83559.1 304 phosphorylcholine cytidylyltransferase2 [Arabidopsis thaliana]
GI:240255851 SwissProt F4JJE0.1 304 RecName: Full=Choline-phosphate cytidylyltransferase 2; Short=AtCCT2; AltName: Full=CTP:phosphocholine cytidylyltransferase 2; AltName: Full=Phosphorylcholine transferase 2 [Arabidopsis thaliana]

Related Sequences to LMP010039 proteins

Reference Database Accession Length Protein Name
GI:240255851 DBBJ BAC01276.1 305 CTP:phosphorylcholine cytidylyltransferase [Arabidopsis thaliana]
GI:240255851 DBBJ BAC01277.1 305 CTP:phosphorylcholine cytidylyltransferase [Arabidopsis thaliana]
GI:240255851 EMBL CAY05210.1 305 unnamed protein product [Arabidopsis thaliana]
GI:240255851 EMBL CBF65920.1 305 unnamed protein product [Arabidopsis thaliana]
GI:240255851 EMBL CBU90792.1 305 unnamed protein product [Arabidopsis thaliana]
GI:240255851 GenBank AGX57884.1 305 Sequence 16069 from patent US 8541208