Gene/Proteome Database (LMPD)

LMPD ID
LMP010117
Gene ID
825331
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Fatty acid/sphingolipid desaturase
Gene Symbol
AT3G61580
Alternate Names
Fatty acid/sphingolipid desaturase
Chromosome
3
EC Number
1.14.19.4

Proteins

Fatty acid/sphingolipid desaturase
Refseq ID NP_191717
Protein GI 15233152
UniProt ID Q9ZRP7
mRNA ID NM_116023
Length 449
RefSeq Status REVIEWED
MAEETEKKYITNEDLKKHNKSGDLWIAIQGKVYNVSDWIKTHPGGDTVILNLVGQDVTDAFIAFHPGTAWHHLDHLFTGYHIRDFQVSEVSRDYRRMAAEFRKLGLFENKGHVTLYTLAFVAAMFLGVLYGVLACTSVFAHQIAAALLGLLWIQSAYIGHDSGHYVIMSNKSYNRFAQLLSGNCLTGISIAWWKWTHNAHHLACNSLDYDPDLQHIPVFAVSTKFFSSLTSRFYDRKLTFDPVARFLVSYQHFTYYPVMCFGRINLFIQTFLLLFSKREVPDRALNFAGILVFWTWFPLLVSCLPNWPERFFFVFTSFTVTALQHIQFTLNHFAADVYVGPPTGSDWFEKQAAGTIDISCRSYMDWFFGGLQFQLEHHLFPRLPRCHLRKVSPVVQELCKKHNLPYRSMSWFEANVLTINTLKTAAYQARDVANPVVKNLVWEALNTHG

Gene Information

Entrez Gene ID
825331
Gene Name
Fatty acid/sphingolipid desaturase
Gene Symbol
AT3G61580
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0016717 IEA:InterPro F oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0052631 IDA:TAIR F sphingolipid delta-8 desaturase activity
GO:0070417 IMP:UniProtKB P cellular response to cold
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0006629 IDA:TAIR P lipid metabolic process
GO:0030148 IMP:UniProtKB P sphingolipid biosynthetic process

REACTOME Pathway Links

REACTOME Pathway ID Description
6254357 Linoleic acid (LA) metabolism
6254331 PPARA activates gene expression
6254358 alpha-linolenic (omega3) and linoleic (omega6) acid metabolism
6254359 alpha-linolenic acid (ALA) metabolism

Domain Information

InterPro Annotations

Accession Description
IPR001199 Cytochrome b5-like heme/steroid binding domain
IPR005804 Fatty acid desaturase, type 1
IPR012171 Fatty acid/sphingolipid desaturase

UniProt Annotations

Entry Information

Gene Name
Fatty acid/sphingolipid desaturase
Protein Entry
SLD1_ARATH
UniProt ID
Q9ZRP7
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Phytosphinganine + reduced acceptor + O(2) = Delta(8)-phytosphingenine + acceptor + 2 H(2)O. {ECO:0000269|PubMed:22023480, ECO:0000269|PubMed:9786850}.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Disruption Phenotype No visible phenotype under normal growth conditions, but mutant plants have strongly reduced levels of unsaturated LCB sphingolipids in all organs and show enhanced sensitivity to prolonged low-temperature exposure. {ECO:0000269|PubMed:22023480}.
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}.
Function Plays a major role as delta(8)-fatty-acid desaturase which introduces a double bond at the 8-position in 20-carbon fatty acids that have an existing delta-11 unsaturation. Involved in the biosynthesis of sphingolipids by catalyzing the formation of unsaturated sphongoid long-chain bases (LCB). This structural modification contributes to the quantitative partitioning of ceramides between the two major sphingolipid classes, glucosylceramides and glycosylinositolphosphoryl ceramides. Sphingolipids are important membrane components involved in environmental stress responses, such as resistance to chilling, and act as cell signaling molecules. {ECO:0000269|PubMed:22023480, ECO:0000269|PubMed:9786850}.
Similarity Belongs to the fatty acid desaturase family. {ECO:0000305}.
Similarity Contains 1 cytochrome b5 heme-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00279}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305|PubMed:22023480}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity Highly expressed in flowers. Expressed in roots, leaves, stems and siliques. {ECO:0000269|PubMed:22023480}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010117 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15233152 RefSeq NP_191717 449 Fatty acid/sphingolipid desaturase

Identical Sequences to LMP010117 proteins

Reference Database Accession Length Protein Name
GI:15233152 GenBank AEF65927.1 449 Sequence 71 from patent US 7932438
GI:15233152 GenBank AEW32756.1 449 Sequence 71 from patent US 8071341
GI:15233152 GenBank AFK97164.1 449 Sequence 71 from patent US 8158392
GI:15233152 GenBank AFL61057.1 449 Sequence 71 from patent US 8106226
GI:15233152 GenBank AGB67212.1 449 Sequence 71 from patent US 8288572
GI:15233152 GenBank AHE22390.1 449 Sequence 71 from patent US 8575377

Related Sequences to LMP010117 proteins

Reference Database Accession Length Protein Name
GI:15233152 GenBank AAD00895.1 446 fatty acid desaturase/cytochrome b5 fusion protein [Arabidopsis thaliana]
GI:15233152 GenBank AAM64895.1 449 delta-8 sphingolipid desaturase [Arabidopsis thaliana]
GI:15233152 GenBank EFH52881.1 449 delta-8 sphingolipid desaturase [Arabidopsis lyrata subsp. lyrata]
GI:15233152 GenBank EOA24022.1 449 hypothetical protein CARUB_v10017244mg [Capsella rubella]
GI:15233152 RefSeq XP_002876622.1 449 delta-8 sphingolipid desaturase [Arabidopsis lyrata subsp. lyrata]
GI:15233152 RefSeq XP_006291124.1 449 hypothetical protein CARUB_v10017244mg [Capsella rubella]