Gene/Proteome Database (LMPD)

LMPD ID
LMP010118
Gene ID
819228
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Fatty acid/sphingolipid desaturase
Gene Symbol
AT2G46210
Synonyms
T3F17.14
Alternate Names
Fatty acid/sphingolipid desaturase
Chromosome
2
EC Number
1.14.19.4

Proteins

Fatty acid/sphingolipid desaturase
Refseq ID NP_182144
Protein GI 15225939
UniProt ID Q3EBF7
mRNA ID NM_130183
Length 449
RefSeq Status REVIEWED
MADQTKKRYVTSEDLKKHNKPGDLWISIQGKVYDVSDWVKSHPGGEAAILNLAGQDVTDAFIAYHPGTAWHHLEKLHNGYHVRDHHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTCVGVMLAAVLYGVLACTSIWAHLISAVLLGLLWIQSAYVGHDSGHYTVTSTKPCNKLIQLLSGNCLTGISIAWWKWTHNAHHIACNSLDHDPDLQHIPIFAVSTKFFNSMTSRFYGRKLTFDPLARFLISYQHWTFYPVMCVGRINLFIQTFLLLFSKRHVPDRALNIAGILVFWTWFPLLVSFLPNWQERFIFVFVSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSFMDWFFGGLQFQLEHHLFPRLPRCHLRTVSPVVKELCKKHNLPYRSLSWWEANVWTIRTLKNAAIQARDATNPVLKNLLWEAVNTHG

Gene Information

Entrez Gene ID
819228
Gene Name
Fatty acid/sphingolipid desaturase
Gene Symbol
AT2G46210
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0016717 IEA:InterPro F oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0052631 IMP:UniProtKB F sphingolipid delta-8 desaturase activity
GO:0070417 IMP:UniProtKB P cellular response to cold
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0030148 IMP:UniProtKB P sphingolipid biosynthetic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5129 sphingolipid biosynthesis (plants)

REACTOME Pathway Links

REACTOME Pathway ID Description
6254357 Linoleic acid (LA) metabolism
6254358 alpha-linolenic (omega3) and linoleic (omega6) acid metabolism
6254359 alpha-linolenic acid (ALA) metabolism

Domain Information

InterPro Annotations

Accession Description
IPR001199 Cytochrome b5-like heme/steroid binding domain
IPR005804 Fatty acid desaturase, type 1
IPR012171 Fatty acid/sphingolipid desaturase

UniProt Annotations

Entry Information

Gene Name
Fatty acid/sphingolipid desaturase
Protein Entry
SLD2_ARATH
UniProt ID
Q3EBF7
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Phytosphinganine + reduced acceptor + O(2) = Delta(8)-phytosphingenine + acceptor + 2 H(2)O. {ECO:0000269|PubMed:22023480}.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Disruption Phenotype No visible phenotype under normal growth conditions, but mutant plants show enhanced sensitivity to prolonged low-temperature exposure. {ECO:0000269|PubMed:22023480}.
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}.
Function Plays a minor role as delta(8)-fatty-acid desaturase which introduces a double bond at the 8-position in 20-carbon fatty acids that have an existing delta-11 unsaturation. Involved in the biosynthesis of sphingolipids by catalyzing the formation of unsaturated sphongoid long-chain bases (LCB). This structural modification contributes to the quantitative partitioning of ceramides between the two major sphingolipid classes, glucosylceramides and glycosylinositolphosphoryl ceramides. Sphingolipids are important membrane components involved in environmental stress responses, such as resistance to chilling, and act as cell signaling molecules. {ECO:0000269|PubMed:22023480}.
Sequence Caution Sequence=AK228217; Type=Frameshift; Positions=16; Evidence={ECO:0000305};
Similarity Belongs to the fatty acid desaturase family. {ECO:0000305}.
Similarity Contains 1 cytochrome b5 heme-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00279}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305|PubMed:22023480}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity Highly expressed in flowers and siliques. Expressed at low levels in roots, leaves and stems. {ECO:0000269|PubMed:22023480}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010118 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15225939 RefSeq NP_182144 449 Fatty acid/sphingolipid desaturase

Identical Sequences to LMP010118 proteins

Reference Database Accession Length Protein Name
GI:15225939 GenBank AEF65926.1 449 Sequence 70 from patent US 7932438
GI:15225939 GenBank AEW32755.1 449 Sequence 70 from patent US 8071341
GI:15225939 GenBank AFK97163.1 449 Sequence 70 from patent US 8158392
GI:15225939 GenBank AFL61056.1 449 Sequence 70 from patent US 8106226
GI:15225939 GenBank AGB67211.1 449 Sequence 70 from patent US 8288572
GI:15225939 GenBank AHE22389.1 449 Sequence 70 from patent US 8575377

Related Sequences to LMP010118 proteins

Reference Database Accession Length Protein Name
GI:15225939 GenBank EFH56483.1 449 hypothetical protein ARALYDRAFT_483768 [Arabidopsis lyrata subsp. lyrata]
GI:15225939 GenBank EOA27107.1 449 hypothetical protein CARUB_v10023205mg [Capsella rubella]
GI:15225939 RefSeq XP_002880224.1 449 hypothetical protein ARALYDRAFT_483768 [Arabidopsis lyrata subsp. lyrata]
GI:15225939 RefSeq XP_006294209.1 449 hypothetical protein CARUB_v10023205mg [Capsella rubella]
GI:15225939 RefSeq XP_010506617.1 449 PREDICTED: delta(8)-fatty-acid desaturase 2 [Camelina sativa]
GI:15225939 RefSeq XP_010518286.1 449 PREDICTED: delta(8)-fatty-acid desaturase 2-like [Camelina sativa]