Gene/Proteome Database (LMPD)
Proteins
| Fatty acid/sphingolipid desaturase | |
|---|---|
| Refseq ID | NP_182144 |
| Protein GI | 15225939 |
| UniProt ID | Q3EBF7 |
| mRNA ID | NM_130183 |
| Length | 449 |
| RefSeq Status | REVIEWED |
| MADQTKKRYVTSEDLKKHNKPGDLWISIQGKVYDVSDWVKSHPGGEAAILNLAGQDVTDAFIAYHPGTAWHHLEKLHNGYHVRDHHVSDVSRDYRRLAAEFSKRGLFDKKGHVTLYTLTCVGVMLAAVLYGVLACTSIWAHLISAVLLGLLWIQSAYVGHDSGHYTVTSTKPCNKLIQLLSGNCLTGISIAWWKWTHNAHHIACNSLDHDPDLQHIPIFAVSTKFFNSMTSRFYGRKLTFDPLARFLISYQHWTFYPVMCVGRINLFIQTFLLLFSKRHVPDRALNIAGILVFWTWFPLLVSFLPNWQERFIFVFVSFAVTAIQHVQFCLNHFAADVYTGPPNGNDWFEKQTAGTLDISCRSFMDWFFGGLQFQLEHHLFPRLPRCHLRTVSPVVKELCKKHNLPYRSLSWWEANVWTIRTLKNAAIQARDATNPVLKNLLWEAVNTHG | |
Gene Information
Entrez Gene ID
Gene Name
Fatty acid/sphingolipid desaturase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0016717 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water |
| GO:0052631 | IMP:UniProtKB | F | sphingolipid delta-8 desaturase activity |
| GO:0070417 | IMP:UniProtKB | P | cellular response to cold |
| GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
| GO:0030148 | IMP:UniProtKB | P | sphingolipid biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-5129 | sphingolipid biosynthesis (plants) |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
Fatty acid/sphingolipid desaturase
Protein Entry
SLD2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phytosphinganine + reduced acceptor + O(2) = Delta(8)-phytosphingenine + acceptor + 2 H(2)O. {ECO:0000269|PubMed:22023480}. |
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Disruption Phenotype | No visible phenotype under normal growth conditions, but mutant plants show enhanced sensitivity to prolonged low-temperature exposure. {ECO:0000269|PubMed:22023480}. |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}. |
| Function | Plays a minor role as delta(8)-fatty-acid desaturase which introduces a double bond at the 8-position in 20-carbon fatty acids that have an existing delta-11 unsaturation. Involved in the biosynthesis of sphingolipids by catalyzing the formation of unsaturated sphongoid long-chain bases (LCB). This structural modification contributes to the quantitative partitioning of ceramides between the two major sphingolipid classes, glucosylceramides and glycosylinositolphosphoryl ceramides. Sphingolipids are important membrane components involved in environmental stress responses, such as resistance to chilling, and act as cell signaling molecules. {ECO:0000269|PubMed:22023480}. |
| Sequence Caution | Sequence=AK228217; Type=Frameshift; Positions=16; Evidence={ECO:0000305}; |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Similarity | Contains 1 cytochrome b5 heme-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00279}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305|PubMed:22023480}; Multi-pass membrane protein {ECO:0000305}. |
| Tissue Specificity | Highly expressed in flowers and siliques. Expressed at low levels in roots, leaves and stems. {ECO:0000269|PubMed:22023480}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010118 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15225939 | RefSeq | NP_182144 | 449 | Fatty acid/sphingolipid desaturase |
Identical Sequences to LMP010118 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15225939 | GenBank | AEF65926.1 | 449 | Sequence 70 from patent US 7932438 |
| GI:15225939 | GenBank | AEW32755.1 | 449 | Sequence 70 from patent US 8071341 |
| GI:15225939 | GenBank | AFK97163.1 | 449 | Sequence 70 from patent US 8158392 |
| GI:15225939 | GenBank | AFL61056.1 | 449 | Sequence 70 from patent US 8106226 |
| GI:15225939 | GenBank | AGB67211.1 | 449 | Sequence 70 from patent US 8288572 |
| GI:15225939 | GenBank | AHE22389.1 | 449 | Sequence 70 from patent US 8575377 |
Related Sequences to LMP010118 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15225939 | GenBank | EFH56483.1 | 449 | hypothetical protein ARALYDRAFT_483768 [Arabidopsis lyrata subsp. lyrata] |
| GI:15225939 | GenBank | EOA27107.1 | 449 | hypothetical protein CARUB_v10023205mg [Capsella rubella] |
| GI:15225939 | RefSeq | XP_002880224.1 | 449 | hypothetical protein ARALYDRAFT_483768 [Arabidopsis lyrata subsp. lyrata] |
| GI:15225939 | RefSeq | XP_006294209.1 | 449 | hypothetical protein CARUB_v10023205mg [Capsella rubella] |
| GI:15225939 | RefSeq | XP_010506617.1 | 449 | PREDICTED: delta(8)-fatty-acid desaturase 2 [Camelina sativa] |
| GI:15225939 | RefSeq | XP_010518286.1 | 449 | PREDICTED: delta(8)-fatty-acid desaturase 2-like [Camelina sativa] |