Gene/Proteome Database (LMPD)
LMPD ID
LMP010119
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
delta-9 acyl-lipid desaturase 1
Gene Symbol
Synonyms
DELTA 9 DESATURASE; delta 9 desaturase 1; T21E18.13; T21E18_13
Alternate Names
delta-9 acyl-lipid desaturase 1
Chromosome
1
EC Number
1.14.19.-
Summary
homologous to delta 9 acyl-lipid desaturases of cyanobacteria and acyl-CoA desaturases of yeast and mammals. expression down-regulated by cold temperature.
Orthologs
Proteins
| delta-9 acyl-lipid desaturase 1 | |
|---|---|
| Refseq ID | NP_172098 |
| Protein GI | 15221393 |
| UniProt ID | O65797 |
| mRNA ID | NM_100489 |
| Length | 305 |
| RefSeq Status | REVIEWED |
| MSLSASEKEENNKKMAADKAEMGRKKRAMWERKWKRLDIVKAFASLFVHFLCLLAPFNFTWPALRVALIVYTVGGLGITVSYHRNLAHRSFKVPKWLEYFFAYCGLLAIQGDPIDWVSTHRYHHQFTDSDRDPHSPNEGFWFSHLLWLFDTGYLVEKCGRRTNVEDLKRQWYYKFLQRTVLYHILTFGFLLYYFGGLSFLTWGMGIGVAMEHHVTCLINSLCHVWGSRTWKTNDTSRNVWWLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRRMAMVR | |
Gene Information
Entrez Gene ID
Gene Name
delta-9 acyl-lipid desaturase 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | IDA:TAIR | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016717 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water |
| GO:0006636 | IEA:UniProtKB-UniPathway | P | unsaturated fatty acid biosynthetic process |
| GO:0042761 | IMP:TAIR | P | very long-chain fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01040 | Biosynthesis of unsaturated fatty acids |
| ko01040 | Biosynthesis of unsaturated fatty acids |
| ath01212 | Fatty acid metabolism |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-782 | glycolipid desaturation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
delta-9 acyl-lipid desaturase 1
Protein Entry
ADS1_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}. |
| Function | Involved in delta-9 desaturation of fatty acids. {ECO:0000269|PubMed:15240892, ECO:0000269|PubMed:17156034, ECO:0000269|PubMed:9559566}. |
| Induction | Down-regulated by cold. {ECO:0000269|PubMed:9559566}. |
| Miscellaneous | Substrate specificity shifts from delta-9 to delta- 7 desaturation when the protein is retargeted to the chloroplast. |
| Pathway | Lipid metabolism; polyunsaturated fatty acid biosynthesis. |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Tissue Specificity | Strongly expressed in inflorescence meristems, leaves, and flowers, and weakly in roots and seedpods. {ECO:0000269|PubMed:9559566}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010119 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15221393 | RefSeq | NP_172098 | 305 | delta-9 acyl-lipid desaturase 1 |
Identical Sequences to LMP010119 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221393 | GenBank | AAV99891.1 | 305 | Sequence 44 from patent US 6762345 |
| GI:15221393 | GenBank | AAX01251.1 | 305 | Sequence 3 from patent US 6838594 |
| GI:15221393 | GenBank | ACP74250.1 | 305 | Sequence 3 from patent US 7495149 |
| GI:15221393 | GenBank | ADF00735.1 | 305 | Sequence 2 from patent US 7655833 |
| GI:15221393 | GenBank | AEE27937.1 | 305 | delta-9 acyl-lipid desaturase 1 [Arabidopsis thaliana] |
| GI:15221393 | SwissProt | O65797.1 | 305 | RecName: Full=Delta-9 acyl-lipid desaturase 1 [Arabidopsis thaliana] |
Related Sequences to LMP010119 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221393 | DBBJ | BAC43716.1 | 305 | putative delta 9 desaturase [Arabidopsis thaliana] |
| GI:15221393 | GenBank | EFH65843.1 | 305 | hypothetical protein ARALYDRAFT_887802 [Arabidopsis lyrata subsp. lyrata] |
| GI:15221393 | RefSeq | XP_002889584.1 | 305 | hypothetical protein ARALYDRAFT_887802 [Arabidopsis lyrata subsp. lyrata] |
| GI:15221393 | RefSeq | XP_010485742.1 | 305 | PREDICTED: delta-9 acyl-lipid desaturase 1-like [Camelina sativa] |
| GI:15221393 | RefSeq | XP_010457724.1 | 305 | PREDICTED: delta-9 acyl-lipid desaturase 1-like [Camelina sativa] |
| GI:15221393 | RefSeq | XP_010475329.1 | 305 | PREDICTED: delta-9 acyl-lipid desaturase 1 [Camelina sativa] |