Gene/Proteome Database (LMPD)

LMPD ID
LMP010120
Gene ID
817694
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
16:0delta9 desaturase 2
Gene Symbol
DS2
Synonyms
16:0delta9 desaturase 2; ADS2; DELTA 9 DESATURASE; DS2; T28P16.15; T28P16_15
Alternate Names
16:0delta9 desaturase 2
Chromosome
2
EC Number
1.14.19.-
Summary
homologous to delta 9 acyl-lipid desaturases of cyanobacteria and acyl-CoA desaturases of yeast and mammals. expression up-regulated by cold temperature.
Orthologs
View orthologs and multiple alignments for DS2

Proteins

16:0delta9 desaturase 2
Refseq ID NP_565721
Protein GI 18402641
UniProt ID Q9SID2
mRNA ID NM_128693
Length 307
RefSeq Status REVIEWED
MSVTSTVEENHQKNPSTPAAVEEKKKRRWVFWDRRWRRLDYVKFSASFTVHSLALLAPFYFTWSALWVTFLFYTIGGLGITVSYHRNLAHRSFKVPKWLEYLLAYCALLAIQGDPIDWVSTHRYHHQFTDSERDPHSPKEGFWFSHLLWIYDSAYLVSKCGRRANVEDLKRQWFYRFLQKTVLFHILGLGFFLFYLGGMSFVTWGMGVGAALEVHVTCLINSLCHIWGTRTWKTNDTSRNVWWLSVFSFGESWHNNHHAFESSARQGLEWWQIDISWYIVRFFEIIGLATDVKVPTEAQRRRMAIVR

Gene Information

Entrez Gene ID
817694
Gene Name
16:0delta9 desaturase 2
Gene Symbol
DS2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0005789 IDA:TAIR C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016717 IEA:InterPro F oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0006636 IEA:UniProtKB-UniPathway P unsaturated fatty acid biosynthetic process
GO:0042761 IMP:TAIR P very long-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01040 Biosynthesis of unsaturated fatty acids
ko01040 Biosynthesis of unsaturated fatty acids
ath01212 Fatty acid metabolism

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-782 glycolipid desaturation

Domain Information

InterPro Annotations

Accession Description
IPR005804 Fatty acid desaturase, type 1
IPR015876 Fatty acid desaturase, type 1, core

UniProt Annotations

Entry Information

Gene Name
16:0delta9 desaturase 2
Protein Entry
ADS2_ARATH
UniProt ID
Q9SID2
Species
Arabidopsis

Comments

Comment Type Description
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}.
Function Involved in delta-9 desaturation of fatty acids. {ECO:0000269|PubMed:15240892, ECO:0000269|PubMed:9559566}.
Induction Up-regulated by cold. {ECO:0000269|PubMed:9559566}.
Miscellaneous Substrate specificity shifts from delta-9 to delta- 7 desaturation when the protein is retargeted to the chloroplast.
Pathway Lipid metabolism; polyunsaturated fatty acid biosynthesis.
Similarity Belongs to the fatty acid desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Tissue Specificity Strongly expressed in flowers, roots, leaves, seedpods, and inflorescence meristems. {ECO:0000269|PubMed:9559566}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010120 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18402641 RefSeq NP_565721 307 16:0delta9 desaturase 2

Identical Sequences to LMP010120 proteins

Reference Database Accession Length Protein Name
GI:18402641 GenBank AAK76592.1 307 putative delta 9 desaturase [Arabidopsis thaliana]
GI:18402641 GenBank AAL85119.1 307 putative delta 9 desaturase [Arabidopsis thaliana]
GI:18402641 GenBank ADF00736.1 307 Sequence 4 from patent US 7655833
GI:18402641 GenBank AEC08533.1 307 16:0delta9 desaturase 2 [Arabidopsis thaliana]
GI:18402641 gnl TIGR 307 delta 9 desaturase [Arabidopsis thaliana]
GI:18402641 SwissProt Q9SID2.2 307 RecName: Full=Delta-9 acyl-lipid desaturase 2 [Arabidopsis thaliana]

Related Sequences to LMP010120 proteins

Reference Database Accession Length Protein Name
GI:18402641 GenBank AAM63359.1 308 delta 9 desaturase [Arabidopsis thaliana]
GI:18402641 GenBank AAV00814.1 306 Sequence 10 from patent US 6737564
GI:18402641 GenBank EFH57430.1 305 hypothetical protein ARALYDRAFT_482064 [Arabidopsis lyrata subsp. lyrata]
GI:18402641 RefSeq XP_002881171.1 305 hypothetical protein ARALYDRAFT_482064 [Arabidopsis lyrata subsp. lyrata]
GI:18402641 RefSeq XP_010414136.1 307 PREDICTED: delta-9 acyl-lipid desaturase 2 isoform X1 [Camelina sativa]
GI:18402641 RefSeq XP_010469700.1 307 PREDICTED: delta-9 acyl-lipid desaturase 2 [Camelina sativa]