Gene/Proteome Database (LMPD)
Proteins
| delta-9 desaturase-like 3 protein | |
|---|---|
| Refseq ID | NP_172102 |
| Protein GI | 15221398 |
| UniProt ID | Q9FPD5 |
| mRNA ID | NM_100493 |
| Length | 299 |
| RefSeq Status | REVIEWED |
| MGDKNKDDSSSQSKAVRKEKRAFLFRKWTRVDVMRVSAVGAVHLLCLLAPFNYTWEAFRFAAMVGISTNLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQFTDSDRDPHSPIEGFWFSHVFWIFDTSYIREKCGGRDNVMDLKQQWFYRFLQNTIGLHILTFWILVYLWGGLPYLTWSVGVGGAIGYHATWLINSACHIWGSRAWNTKDTSRNIWWLGPFTMGESWHNNHHAFEASARHGLEWYQVDLTWYLIWFFQVLGLATDVKLPTDAQKRKMSLAR | |
Gene Information
Entrez Gene ID
Gene Name
delta-9 desaturase-like 3 protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016717 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water |
| GO:0006636 | IEA:UniProtKB-UniPathway | P | unsaturated fatty acid biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-782 | glycolipid desaturation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
delta-9 desaturase-like 3 protein
Protein Entry
ADSL3_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}. |
| Pathway | Lipid metabolism; polyunsaturated fatty acid biosynthesis. |
| Sequence Caution | Sequence=AAF80135.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010123 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15221398 | RefSeq | NP_172102 | 299 | delta-9 desaturase-like 3 protein |
Identical Sequences to LMP010123 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221398 | DBBJ | BAC42216.1 | 299 | putative delta 9 desaturase [Arabidopsis thaliana] |
| GI:15221398 | GenBank | AAG48797.1 | 299 | putative delta 9 desaturase [Arabidopsis thaliana] |
| GI:15221398 | GenBank | AEE27941.1 | 299 | delta-9 desaturase-like 3 protein [Arabidopsis thaliana] |
| GI:15221398 | SwissProt | Q9FPD5.1 | 299 | RecName: Full=Delta-9 desaturase-like 3 protein [Arabidopsis thaliana] |
Related Sequences to LMP010123 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221398 | GenBank | AAF80132.1 | 299 | Contains similarity to delta 9 desaturase mRNA from Arabidopsis thaliana gb|D88536 and contains a fatty acid desaturase PF|01069 domain. ESTs gb|AV546954, gb|AI993202, gb|AV554343, gb|T46147 come from this gene [Arabidopsis thaliana] |
| GI:15221398 | GenBank | AAF80135.1 | 287 | Contains similarity to delta 9 desaturase mRNA from Arabidopsis thaliana gb|D88536 and contains a fatty acid desaturase PF|01069 domain. ESTs gb|AI993202. gb|T46147, gb|AV554343, gb|AV539469 come from this gene [Arabidopsis thaliana] |
| GI:15221398 | GenBank | ADT59589.1 | 299 | Sequence 68 from patent US 7847156 |
| GI:15221398 | GenBank | AEE27938.1 | 299 | delta-9 desaturase-like 1 protein [Arabidopsis thaliana] |
| GI:15221398 | RefSeq | NP_172099.1 | 299 | delta-9 desaturase-like 1 protein [Arabidopsis thaliana] |
| GI:15221398 | SwissProt | Q9LND9.1 | 299 | RecName: Full=Delta-9 desaturase-like 1 protein [Arabidopsis thaliana] |