Gene/Proteome Database (LMPD)
Proteins
| delta-9 desaturase-like 5 protein | |
|---|---|
| Refseq ID | NP_172125 |
| Protein GI | 15221454 |
| UniProt ID | Q9LMI3 |
| mRNA ID | NM_100517 |
| Length | 299 |
| RefSeq Status | REVIEWED |
| MCDPIREDGSNKRGAVSKEKRPYIHREWSWADIIRALTVINVHFLCLLAPFNYKWEALRFGFVLYALTSLSITFSYHRNLAHRSFKLPKWLEYPLAYFAVFALQGDPLDWVSIHRFHHQFTDSDRDPHSPIEGFWFSHVWWICDTRYIKYKCGGRNNVMDLKQQWFYWFLRMTIGFHVLMFWTVLYLYGGLPYLTCGGGVGGVIGYHVTWLVNSACHIWGSRSWKTKDTSRNVWWLSLFTMGESWHNNHHAFESSARQGLEWWQIDITWYLIRLFEVLGLATDVKLPSEIQKQKLALTR | |
Gene Information
Entrez Gene ID
Gene Name
delta-9 desaturase-like 5 protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016717 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water |
| GO:0006636 | IEA:UniProtKB-UniPathway | P | unsaturated fatty acid biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-782 | glycolipid desaturation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
delta-9 desaturase-like 5 protein
Protein Entry
ADSL5_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
| Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. {ECO:0000250}. |
| Pathway | Lipid metabolism; polyunsaturated fatty acid biosynthesis. |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010125 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15221454 | RefSeq | NP_172125 | 299 | delta-9 desaturase-like 5 protein |
Identical Sequences to LMP010125 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221454 | GenBank | AAF82164.1 | 299 | Contains similarity to a delta 9 desaturase from Arabidopsis thaliana gb|D88537 and contains a fatty acid desaturase PF|01069 domain. ESTs gb|AA041026, gb|AI992605 come from this gene [Arabidopsis thaliana] |
| GI:15221454 | GenBank | AAG48790.1 | 299 | putative delta 9 desaturase [Arabidopsis thaliana] |
| GI:15221454 | GenBank | AEE27978.1 | 299 | delta-9 desaturase-like 5 protein [Arabidopsis thaliana] |
| GI:15221454 | SwissProt | Q9LMI3.1 | 299 | RecName: Full=Delta-9 desaturase-like 5 protein [Arabidopsis thaliana] |
Related Sequences to LMP010125 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221454 | GenBank | EFH68596.1 | 299 | fatty acid desaturase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15221454 | GenBank | EOA37569.1 | 297 | hypothetical protein CARUB_v10011896mg [Capsella rubella] |
| GI:15221454 | RefSeq | XP_002892337.1 | 299 | fatty acid desaturase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15221454 | RefSeq | XP_006304671.1 | 297 | hypothetical protein CARUB_v10011896mg [Capsella rubella] |
| GI:15221454 | RefSeq | XP_010486028.1 | 299 | PREDICTED: delta-9 desaturase-like 5 protein [Camelina sativa] |
| GI:15221454 | RefSeq | XP_010457762.1 | 299 | PREDICTED: delta-9 desaturase-like 5 protein [Camelina sativa] |