Gene/Proteome Database (LMPD)
Proteins
| diacylglycerol O-acyltransferase 2 | |
|---|---|
| Refseq ID | NP_566952 |
| Protein GI | 18409359 |
| UniProt ID | Q9ASU1 |
| mRNA ID | NM_115011 |
| Length | 314 |
| RefSeq Status | REVIEWED |
| MGGSREFRAEEHSNQFHSIIAMAIWLGAIHFNVALVLCSLIFLPPSLSLMVLGLLSLFIFIPIDHRSKYGRKLARYICKHACNYFPVSLYVEDYEAFQPNRAYVFGYEPHSVLPIGVVALCDLTGFMPIPNIKVLASSAIFYTPFLRHIWTWLGLTAASRKNFTSLLDSGYSCVLVPGGVQETFHMQHDAENVFLSRRRGFVRIAMEQGSPLVPVFCFGQARVYKWWKPDCDLYLKLSRAIRFTPICFWGVFGSPLPCRQPMHVVVGKPIEVTKTLKPTDEEIAKFHGQYVEALRDLFERHKSRVGYDLELKIL | |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol O-acyltransferase 2
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004144 | IDA:TAIR | F | diacylglycerol O-acyltransferase activity |
| GO:0006071 | IEA:UniProtKB-KW | P | glycerol metabolic process |
| GO:0019432 | IDA:TAIR | P | triglyceride biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| TRIGLSYN-PWY | triacylglycerol biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007130 | Diacylglycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
diacylglycerol O-acyltransferase 2
Protein Entry
DGAT2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + 1,2-diacylglycerol = CoA + triacylglycerol. |
| Disruption Phenotype | No decrease in oil content. {ECO:0000269|PubMed:20040537}. |
| Function | Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for storage lipid synthesis (By similarity). {ECO:0000250}. |
| Pathway | Glycerolipid metabolism; triacylglycerol biosynthesis. |
| Sequence Caution | Sequence=CAB63016.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the diacylglycerol acyltransferase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Tissue Specificity | Ubiquitous. Lower levels in seeds than in other tissues. {ECO:0000269|PubMed:20101470}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010136 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18409359 | RefSeq | NP_566952 | 314 | diacylglycerol O-acyltransferase 2 |
Identical Sequences to LMP010136 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18409359 | GenBank | ABL51164.1 | 314 | Sequence 96 from patent US 7135617 |
| GI:18409359 | GenBank | ADR90375.1 | 314 | Sequence 96 from patent US 7741532 |
| GI:18409359 | GenBank | ADT60560.1 | 314 | Sequence 2010 from patent US 7847156 |
| GI:18409359 | GenBank | AEE78802.1 | 314 | diacylglycerol O-acyltransferase 2 [Arabidopsis thaliana] |
| GI:18409359 | GenBank | AFA83934.1 | 314 | Sequence 60 from patent US 8101818 |
| GI:18409359 | GenBank | AGN69108.1 | 314 | Sequence 15 from patent US 8431772 |
Related Sequences to LMP010136 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18409359 | EMBL | CAB63016.1 | 327 | putative protein [Arabidopsis thaliana] |
| GI:18409359 | GenBank | ABL51170.1 | 314 | Sequence 125 from patent US 7135617 |
| GI:18409359 | GenBank | ACJ97004.1 | 314 | Sequence 32 from patent US 7417176 |
| GI:18409359 | GenBank | ADR90381.1 | 314 | Sequence 125 from patent US 7741532 |
| GI:18409359 | GenBank | AEF63660.1 | 314 | Sequence 32 from patent US 7935863 |
| GI:18409359 | GenBank | AEF76539.1 | 314 | Sequence 32 from patent US 7939714 |