Gene/Proteome Database (LMPD)

LMPD ID
LMP010211
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
fatty acid hydroxylase 1
Gene Symbol
Synonyms
ARABIDOPSIS FATTY ACID HYDROXYLASE 1; ATFAH1; FAH1; FAH1P; fatty acid hydroxylase 1; T29F13.2; T29F13_2
Alternate Names
fatty acid hydroxylase 1
Chromosome
2
EC Number
1.-.-.-
Summary
encodes a fatty acid hydroxylase, required for the AtBI-1-mediated suppression of programmed cell death.
Orthologs

Proteins

fatty acid hydroxylase 1
Refseq ID NP_181023
Protein GI 15226828
UniProt ID O48916
mRNA ID NM_129030
Length 237
RefSeq Status REVIEWED
MVAQGFTVDLKKPLVFQVGHLGEDYEEWVHQPIATKEGPRFFQSDFWEFLTLTVWWAVPVIWLPVVVWCISRSVSMGCSLPEIVPIVVMGIFIWTFFEYVLHRFVFHIKTKSYWGNTAHYLIHGCHHKHPMDHLRLVFPPTATAILCFPFWNIAKAISTPSTAPALFGGGMLGYVMYDVTHYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFGTLPTTKAPRKEQ

Gene Information

Entrez Gene ID
Gene Name
fatty acid hydroxylase 1
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0080132 IGI:TAIR F fatty acid alpha-hydroxylase activity
GO:0005506 IEA:InterPro F iron ion binding
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0043069 IGI:TAIR P negative regulation of programmed cell death
GO:0000038 IDA:TAIR P very long-chain fatty acid metabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5129 sphingolipid biosynthesis (plants)
PWY-5129 sphingolipid biosynthesis (plants)

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
fatty acid hydroxylase 1
Protein Entry
FAH1_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Fatty acid 2-hydroxylase involved in the alpha- hydroxylation of sphingolipid-associated very long-chain fatty acids (VLCFA). Probably involved in the resistance response to oxidative stress. {ECO:0000269|PubMed:22635113, ECO:0000269|PubMed:9353282}.
Induction Up-regulated by H(2)O(2) treatment. {ECO:0000269|PubMed:22635113}.
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:22635113}; Multi-pass membrane protein {ECO:0000269|PubMed:22635113}.
Subunit Interacts with CYTB5-A, CYTB5-B, CYTB5-C and CYTB5-D. Interacts indirectly with BI-1 via CYTB5-D. {ECO:0000269|PubMed:19054355, ECO:0000269|PubMed:22635113}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010211 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15226828 RefSeq NP_181023 237 fatty acid hydroxylase 1

Identical Sequences to LMP010211 proteins

Reference Database Accession Length Protein Name
GI:15226828 EMBL CBL63526.1 237 unnamed protein product [Arabidopsis thaliana]
GI:15226828 EMBL CBL54361.1 237 unnamed protein product [Arabidopsis thaliana]
GI:15226828 GenBank ADT59871.1 237 Sequence 632 from patent US 7847156
GI:15226828 GenBank AEC09019.1 237 fatty acid hydroxylase 1 [Arabidopsis thaliana]
GI:15226828 GenBank AEW40086.1 237 Sequence 32 from patent US 8071749
GI:15226828 GenBank AGU20506.1 237 Sequence 32 from patent US 8519114

Related Sequences to LMP010211 proteins

Reference Database Accession Length Protein Name
GI:15226828 GenBank EFH55773.1 237 hypothetical protein ARALYDRAFT_345212 [Arabidopsis lyrata subsp. lyrata]
GI:15226828 RefSeq XP_002879514.1 237 hypothetical protein ARALYDRAFT_345212 [Arabidopsis lyrata subsp. lyrata]
GI:15226828 RefSeq XP_006294911.1 237 hypothetical protein CARUB_v10023963mg [Capsella rubella]
GI:15226828 RefSeq XP_010504961.1 237 PREDICTED: fatty acid 2-hydroxylase 1 [Camelina sativa]
GI:15226828 RefSeq XP_010509705.1 237 PREDICTED: fatty acid 2-hydroxylase 1-like [Camelina sativa]
GI:15226828 RefSeq XP_010516639.1 237 PREDICTED: fatty acid 2-hydroxylase 1-like [Camelina sativa]