Gene/Proteome Database (LMPD)
LMPD ID
LMP010211
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
fatty acid hydroxylase 1
Gene Symbol
Synonyms
ARABIDOPSIS FATTY ACID HYDROXYLASE 1; ATFAH1; FAH1; FAH1P; fatty acid hydroxylase 1; T29F13.2; T29F13_2
Alternate Names
fatty acid hydroxylase 1
Chromosome
2
EC Number
1.-.-.-
Summary
encodes a fatty acid hydroxylase, required for the AtBI-1-mediated suppression of programmed cell death.
Orthologs
Proteins
fatty acid hydroxylase 1 | |
---|---|
Refseq ID | NP_181023 |
Protein GI | 15226828 |
UniProt ID | O48916 |
mRNA ID | NM_129030 |
Length | 237 |
RefSeq Status | REVIEWED |
MVAQGFTVDLKKPLVFQVGHLGEDYEEWVHQPIATKEGPRFFQSDFWEFLTLTVWWAVPVIWLPVVVWCISRSVSMGCSLPEIVPIVVMGIFIWTFFEYVLHRFVFHIKTKSYWGNTAHYLIHGCHHKHPMDHLRLVFPPTATAILCFPFWNIAKAISTPSTAPALFGGGMLGYVMYDVTHYYLHHAQPTRPVTKNLKKYHLNHHFRIQDKGFGITSSLWDIVFGTLPTTKAPRKEQ |
Gene Information
Entrez Gene ID
Gene Name
fatty acid hydroxylase 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0080132 | IGI:TAIR | F | fatty acid alpha-hydroxylase activity |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
GO:0043069 | IGI:TAIR | P | negative regulation of programmed cell death |
GO:0000038 | IDA:TAIR | P | very long-chain fatty acid metabolic process |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Fatty acid 2-hydroxylase involved in the alpha- hydroxylation of sphingolipid-associated very long-chain fatty acids (VLCFA). Probably involved in the resistance response to oxidative stress. {ECO:0000269|PubMed:22635113, ECO:0000269|PubMed:9353282}. |
Induction | Up-regulated by H(2)O(2) treatment. {ECO:0000269|PubMed:22635113}. |
Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:22635113}; Multi-pass membrane protein {ECO:0000269|PubMed:22635113}. |
Subunit | Interacts with CYTB5-A, CYTB5-B, CYTB5-C and CYTB5-D. Interacts indirectly with BI-1 via CYTB5-D. {ECO:0000269|PubMed:19054355, ECO:0000269|PubMed:22635113}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010211 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15226828 | RefSeq | NP_181023 | 237 | fatty acid hydroxylase 1 |
Identical Sequences to LMP010211 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15226828 | EMBL | CBL63526.1 | 237 | unnamed protein product [Arabidopsis thaliana] |
GI:15226828 | EMBL | CBL54361.1 | 237 | unnamed protein product [Arabidopsis thaliana] |
GI:15226828 | GenBank | ADT59871.1 | 237 | Sequence 632 from patent US 7847156 |
GI:15226828 | GenBank | AEC09019.1 | 237 | fatty acid hydroxylase 1 [Arabidopsis thaliana] |
GI:15226828 | GenBank | AEW40086.1 | 237 | Sequence 32 from patent US 8071749 |
GI:15226828 | GenBank | AGU20506.1 | 237 | Sequence 32 from patent US 8519114 |
Related Sequences to LMP010211 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15226828 | GenBank | EFH55773.1 | 237 | hypothetical protein ARALYDRAFT_345212 [Arabidopsis lyrata subsp. lyrata] |
GI:15226828 | RefSeq | XP_002879514.1 | 237 | hypothetical protein ARALYDRAFT_345212 [Arabidopsis lyrata subsp. lyrata] |
GI:15226828 | RefSeq | XP_006294911.1 | 237 | hypothetical protein CARUB_v10023963mg [Capsella rubella] |
GI:15226828 | RefSeq | XP_010504961.1 | 237 | PREDICTED: fatty acid 2-hydroxylase 1 [Camelina sativa] |
GI:15226828 | RefSeq | XP_010509705.1 | 237 | PREDICTED: fatty acid 2-hydroxylase 1-like [Camelina sativa] |
GI:15226828 | RefSeq | XP_010516639.1 | 237 | PREDICTED: fatty acid 2-hydroxylase 1-like [Camelina sativa] |