Gene/Proteome Database (LMPD)
LMPD ID
LMP010215
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein
Gene Symbol
Synonyms
F19K23.12; F19K23_12
Alternate Names
kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein
Chromosome
1
EC Number
1.14.19.-
Proteins
| kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein | |
|---|---|
| Refseq ID | NP_176410 |
| Protein GI | 15220724 |
| UniProt ID | O04584 |
| mRNA ID | NM_104900 |
| Length | 295 |
| RefSeq Status | REVIEWED |
| MAVSFQTKNPLRPITNIPRSYGPTRVRVTCSVTTTNPQLNHENLVVEKRLVNPPLSKNNDPTLQSTWTHRLWVAAGSTTIFASFAKSIIGGFGSHLWLQPALACYAGYVFADLGSGVYHWAIDNYGGASTPIVGAQLEASQGHHKYPWTITKRQFANNSYTIARAITFIVLPLNLAINNPLFHSFVSTFAFCILLSQQFHAWAHGTKSKLPPLVMALQDMGLLVSRKDHPGHHQAPYNSNYCVVSGAWNKVLDESNLFKALEMALFFQFGVRPNSWNEPNSDWTEETETNFFTKI | |
Gene Information
Entrez Gene ID
Gene Name
kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IEA:UniProtKB-KW | C | chloroplast |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
| GO:0006631 | IEA:UniProtKB-UniPathway | P | fatty acid metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR019547 | B-domain containing protein Kua |
UniProt Annotations
Entry Information
Gene Name
kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein
Protein Entry
FD4L1_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Function | Fatty acid desaturase involved in the production of chloroplast-specific phosphatidylglycerol molecular species. Catalyzes the formation of a trans double bond introduced close to the carboxyl group of palmitic acid, which is specifically esterified to the sn-2 glyceryl carbon of phosphatidylglycerol (By similarity). {ECO:0000250}. |
| Pathway | Lipid metabolism; fatty acid metabolism. |
| Similarity | Belongs to the fatty acid desaturase family. {ECO:0000305}. |
| Subcellular Location | Plastid, chloroplast membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010215 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15220724 | RefSeq | NP_176410 | 295 | kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein |
Identical Sequences to LMP010215 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15220724 | GenBank | AAB60765.1 | 295 | F19K23.12 gene product [Arabidopsis thaliana] |
| GI:15220724 | GenBank | AEE33934.1 | 295 | kua-ubiquitin conjugating enzyme hybrid localisation domain-containing protein [Arabidopsis thaliana] |
| GI:15220724 | SwissProt | O04584.1 | 295 | RecName: Full=Fatty acid desaturase 4-like 1, chloroplastic; Short=FAD4-L1; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010215 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15220724 | GenBank | EFH64296.1 | 288 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15220724 | GenBank | EOA34575.1 | 295 | hypothetical protein CARUB_v10022130mg [Capsella rubella] |
| GI:15220724 | GenBank | KFK29210.1 | 295 | hypothetical protein AALP_AA7G103400 [Arabis alpina] |
| GI:15220724 | RefSeq | XP_002888037.1 | 288 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15220724 | RefSeq | XP_006301677.1 | 295 | hypothetical protein CARUB_v10022130mg [Capsella rubella] |
| GI:15220724 | RefSeq | XP_010430256.1 | 295 | PREDICTED: fatty acid desaturase 4-like 1, chloroplastic [Camelina sativa] |