Gene/Proteome Database (LMPD)

LMPD ID
LMP010242
Gene ID
834101
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
GDSL lipase 1
Gene Symbol
GLIP1
Synonyms
GDSL lipase 1; GLIP1; MEE6.6; MEE6_6
Alternate Names
GDSL lipase 1
Chromosome
5
EC Number
3.1.1.-

Proteins

GDSL lipase 1
Refseq ID NP_198915
Protein GI 15237530
UniProt ID Q9FLN0
mRNA ID NM_123464
Length 374
RefSeq Status REVIEWED
MENSQLVSITFLAYTIIISIGSINCIDNNNLVTNQSALFVFGDSVFDAGNNNYIDTLSSVRSNYWPYGQTTFKSPTGRVSDGRLIPDFIAEYAWLPLIPPNLQPFNGNSQFAYGVNFASGGAGALVGTFSGLVINLRTQLNNFKKVEEMLRSKLGDAEGKRVISRAVYLFHIGLNDYQYPFTTNSSLFQSISNEKYVDYVVGNMTDVFKEVYNLGGRKFGILNTGPYDCAPASLVIDQTKIRSCFQPVTELINMHNEKLLNGLRRLNHELSGFKYALHDYHTSLSERMNDPSKYGFKEGKKACCGSGPLRGINTCGGRMGLSQSYELCENVTDYLFFDPFHLTEKANRQIAELIWSGPTNITGPYNLKALFELN

Gene Information

Entrez Gene ID
834101
Gene Name
GDSL lipase 1
Gene Symbol
GLIP1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005615 IDA:UniProtKB C extracellular space
GO:0016298 IDA:UniProtKB F lipase activity
GO:0042742 IMP:TAIR P defense response to bacterium
GO:0050832 IMP:TAIR P defense response to fungus
GO:0009817 IMP:UniProtKB P defense response to fungus, incompatible interaction
GO:0009866 IMP:TAIR P induced systemic resistance, ethylene mediated signaling pathway
GO:0009871 IMP:UniProtKB P jasmonic acid and ethylene-dependent systemic resistance, ethylene mediated signaling pathway
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0009620 IMP:TAIR P response to fungus
GO:0009751 IEP:TAIR P response to salicylic acid
GO:0009627 IMP:UniProtKB P systemic acquired resistance

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-3301 sinapate ester biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001087 Lipase, GDSL
IPR008265 Lipase, GDSL, active site

UniProt Annotations

Entry Information

Gene Name
GDSL lipase 1
Protein Entry
GLIP1_ARATH
UniProt ID
Q9FLN0
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype In the resistant cv. Columbia (glip1-1 and glip1-2), confers susceptibility to A.brassicicola. {ECO:0000269|PubMed:16126835}.
Function Confers resistance to the necrotrophic fungus Alternaria brassicicola. Possesses lipase and antimicrobial activities that directly disrupt fungal spore integrity. Triggers systemic resistance, mostly by the ethylene-dependent pathway. {ECO:0000269|PubMed:16126835}.
Induction By ethylene. {ECO:0000269|PubMed:16126835}.
Similarity Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000269|PubMed:16126835}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010242 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15237530 RefSeq NP_198915 374 GDSL lipase 1

Identical Sequences to LMP010242 proteins

Reference Database Accession Length Protein Name
GI:15237530 EMBL CBC09181.1 374 unnamed protein product [Arabidopsis thaliana]
GI:15237530 EMBL CBC10303.1 374 unnamed protein product [Arabidopsis thaliana]
GI:15237530 EMBL CBC89666.1 374 unnamed protein product [Arabidopsis thaliana]
GI:15237530 EMBL CBC58534.1 374 unnamed protein product [Arabidopsis thaliana]
GI:15237530 EMBL CBC57287.1 374 unnamed protein product [Arabidopsis thaliana]
GI:15237530 gnl TAIR 374 GDSL lipase 1 [Arabidopsis thaliana]

Related Sequences to LMP010242 proteins

Reference Database Accession Length Protein Name
GI:15237530 GenBank EFH46920.1 368 hypothetical protein ARALYDRAFT_493878 [Arabidopsis lyrata subsp. lyrata]
GI:15237530 GenBank EOA18935.1 376 hypothetical protein CARUB_v10007566mg [Capsella rubella]
GI:15237530 RefSeq XP_002870661.1 368 hypothetical protein ARALYDRAFT_493878 [Arabidopsis lyrata subsp. lyrata]
GI:15237530 RefSeq XP_006286037.1 376 hypothetical protein CARUB_v10007566mg [Capsella rubella]
GI:15237530 RefSeq XP_010501060.1 378 PREDICTED: GDSL esterase/lipase 2 [Camelina sativa]
GI:15237530 RefSeq XP_010436851.1 384 PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase 1-like [Camelina sativa]