Gene/Proteome Database (LMPD)
Proteins
| GDSL esterase/lipase | |
|---|---|
| Refseq ID | NP_029729 |
| Protein GI | 18402700 |
| UniProt ID | Q9SIQ2 |
| mRNA ID | NM_128712 |
| Length | 219 |
| RefSeq Status | REVIEWED |
| MFKSYIARLKGIVGDKKAMEIINNAFVVVSAGPNDFILNYYDIPSRRLEYPFISGYQDFILKRLENFVRELYSLGVRNVLVGGLPPMGCLPIHMTAKFRNIFRFCLEHHNKDSVLYNEKLQKLLPQIEASLPGSKFLYADVYNPMMEMIQNPSKYGFKETKRGCCGTGFLETSFMCNVFSPVCQNRSEFMFFDSIHPSEATYNVIGNRLDPLIRGKFQA | |
Gene Information
Entrez Gene ID
Gene Name
GDSL esterase/lipase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| LIPAS-PWY | triacylglycerol degradation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001087 | Lipase, GDSL |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Sequence Caution | Sequence=AAD24834.2; Type=Frameshift; Positions=122; Evidence={ECO:0000305}; Sequence=AEC08559.1; Type=Frameshift; Positions=122; Evidence={ECO:0000305}; |
| Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
| Subcellular Location | Secreted {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010290 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18402700 | RefSeq | NP_029729 | 219 | GDSL esterase/lipase |
Identical Sequences to LMP010290 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18402700 | GenBank | ACX04369.1 | 219 | Sequence 27169 from patent US 7569389 |
| GI:18402700 | GenBank | AEC08559.1 | 219 | GDSL esterase/lipase [Arabidopsis thaliana] |
| GI:18402700 | gnl | TIGR | 219 | putative GDSL-motif lipase/hydrolase [Arabidopsis thaliana] |
Related Sequences to LMP010290 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18402700 | EMBL | CAW53806.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:18402700 | EMBL | CAW70203.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:18402700 | EMBL | CAW60591.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:18402700 | EMBL | CAW44992.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:18402700 | EMBL | CAW87364.1 | 360 | unnamed protein product [Arabidopsis thaliana] |
| GI:18402700 | SwissProt | Q9SIQ2.3 | 360 | RecName: Full=GDSL esterase/lipase At2g31550; AltName: Full=Extracellular lipase At2g31550; Flags: Precursor [Arabidopsis thaliana] |