Gene/Proteome Database (LMPD)
Proteins
GDSL esterase/lipase | |
---|---|
Refseq ID | NP_565883 |
Protein GI | 18404664 |
UniProt ID | O80443 |
mRNA ID | NM_129374 |
Length | 312 |
RefSeq Status | REVIEWED |
MVGPVRPQIVLFGSSIVQYSFTDRGWGATLADLYSRTADIILRGYAGWNSRFALKVLHQVFPKDAVIQPSLVIVYFGGNDSTHPHPSGHGPHVPLSEFIENMRKIGEHLLSLSDKTRVIFLTPPPMNEKQIEIVFGDAIKGRSNELCRPYAEELLNLCREINVKGIDIWTAIQQQDDWLNSCFTDGIHFTAKASEIVVKEILKVLRGADWKPSLYWKSLPVEFPFDFDAPNSISLHDLELTRNNHFESPHLVSLCEQELTRNEQLEPPHPVSLCDHELTRNEQLEPPHPVSLCDHELTQNEQLEPPQPTARL |
Gene Information
Entrez Gene ID
Gene Name
GDSL esterase/lipase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001087 | Lipase, GDSL |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Caution | Lacks the conserved active site 'GDSL' motif. Its enzyme activity is therefore unsure. {ECO:0000305}. |
Similarity | Belongs to the 'GDSL' lipolytic enzyme family. {ECO:0000305}. |
Subcellular Location | Secreted {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010292 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
18404664 | RefSeq | NP_565883 | 312 | GDSL esterase/lipase |
Identical Sequences to LMP010292 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18404664 | GenBank | AAX12857.1 | 312 | At2g38180 [Arabidopsis thaliana] |
GI:18404664 | GenBank | AAX12886.1 | 312 | At2g38180 [Arabidopsis thaliana] |
GI:18404664 | GenBank | AEC09502.1 | 312 | GDSL esterase/lipase [Arabidopsis thaliana] |
GI:18404664 | gnl | TIGR | 312 | expressed protein [Arabidopsis thaliana] |
GI:18404664 | SwissProt | O80443.1 | 312 | RecName: Full=GDSL esterase/lipase At2g38180; AltName: Full=Extracellular lipase At2g38180; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010292 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18404664 | GenBank | AAL31218.1 | 312 | At2g38180/F16M14.11 [Arabidopsis thaliana] |
GI:18404664 | GenBank | EFH55989.1 | 294 | GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18404664 | RefSeq | XP_002879730.1 | 294 | GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18404664 | RefSeq | XP_009133234.1 | 250 | PREDICTED: GDSL esterase/lipase At2g38180-like [Brassica rapa] |
GI:18404664 | RefSeq | XP_010509212.1 | 273 | PREDICTED: GDSL esterase/lipase At2g38180-like isoform X1 [Camelina sativa] |
GI:18404664 | RefSeq | XP_010517106.1 | 273 | PREDICTED: GDSL esterase/lipase At2g38180 isoform X1 [Camelina sativa] |