Gene/Proteome Database (LMPD)

LMPD ID
LMP010379
Gene ID
819674
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
putative gibberellin receptor GID1L1
Gene Symbol
GID1A
Synonyms
ATGID1A; GA INSENSITIVE DWARF1A; GID1A; T12H1.8; T12H1_8
Alternate Names
putative gibberellin receptor GID1L1
Chromosome
3
EC Number
3.-.-.-
Summary
Encodes a gibberellin (GA) receptor ortholog of the rice GA receptor gene (OsGID1). Has GA-binding activity, showing higher affinity to GA4. Interacts with DELLA proteins in vivo in the presence of GA4. The DELLA region alone can interact with GID1A in GA-dependent manner in a Y2H assay.
Orthologs
View orthologs and multiple alignments for GID1A

Proteins

putative gibberellin receptor GID1L1
Refseq ID NP_187163
Protein GI 15229905
UniProt ID Q9MAA7
mRNA ID NM_111384
Length 345
RefSeq Status REVIEWED
MAASDEVNLIESRTVVPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLIRDWQLAYAEGLKKAGQEVKLMHLEKATVGFYLLPNNNHFHNVMDEISAFVNAEC

Gene Information

Entrez Gene ID
819674
Gene Name
putative gibberellin receptor GID1L1
Gene Symbol
GID1A
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:TAIR C cytoplasm
GO:0005634 IDA:TAIR C nucleus
GO:0010331 IDA:UniProtKB F gibberellin binding
GO:0016787 IEA:UniProtKB-KW F hydrolase activity
GO:0048444 IGI:TAIR P floral organ morphogenesis
GO:0009740 IEA:UniProtKB-KW P gibberellic acid mediated signaling pathway
GO:0010476 IGI:TAIR P gibberellin mediated signaling pathway
GO:0009939 IGI:TAIR P positive regulation of gibberellic acid mediated signaling pathway
GO:0010325 IGI:TAIR P raffinose family oligosaccharide biosynthetic process
GO:0009739 IGI:TAIR P response to gibberellin

KEGG Pathway Links

KEGG Pathway ID Description
ath04075 Plant hormone signal transduction
ko04075 Plant hormone signal transduction

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-2083 isoflavonoid biosynthesis II

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR013094 Alpha/beta hydrolase fold-3
IPR002168 Lipase, GDXG, active site

UniProt Annotations

Entry Information

Gene Name
putative gibberellin receptor GID1L1
Protein Entry
GID1A_ARATH
UniProt ID
Q9MAA7
Species
Arabidopsis

Comments

Comment Type Description
Disruption Phenotype No visible phenotype under normal growth condition. {ECO:0000269|PubMed:17194763, ECO:0000269|PubMed:17521411}.
Function Functions as soluble gibberellin (GA) receptor. GA is an essential hormone that regulates growth and development in plants. Binds with high affinity the biologically active gibberellin GA4, but has no affinity for the biologically inactive GAs. In response to GA, interacts with specific DELLA proteins, known as repressors of GA-induced growth, and targets them for degradation via proteasome. Seems to be required for GA signaling that controls root growth, seed germination, stem elongation and flower development. Partially redundant with GID1B and GID1C. {ECO:0000269|PubMed:16709201, ECO:0000269|PubMed:17194763, ECO:0000269|PubMed:17521411}.
Interaction Q9LQT8:GAI; NbExp=6; IntAct=EBI-963597, EBI-963606; Q9STX3:GID2; NbExp=3; IntAct=EBI-963597, EBI-619033; Q9SLH3:RGA; NbExp=7; IntAct=EBI-963597, EBI-963624; Q8GXW1:RGL2; NbExp=3; IntAct=EBI-963597, EBI-963665;
Similarity Belongs to the 'GDXG' lipolytic enzyme family. {ECO:0000305}.
Subcellular Location Nucleus {ECO:0000250}.
Subunit Interacts (via N-terminus) with the DELLA proteins GAI, RGA, RGL1, RGL2 and RGL3 (via N-terminus) in a GA-dependent manner. {ECO:0000269|PubMed:16709201, ECO:0000269|PubMed:17194763, ECO:0000269|PubMed:19037309, ECO:0000269|PubMed:19500306}.
Tissue Specificity Widely expressed. {ECO:0000269|PubMed:14738307}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010379 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15229905 RefSeq NP_187163 345 putative gibberellin receptor GID1L1

Identical Sequences to LMP010379 proteins

Reference Database Accession Length Protein Name
GI:15229905 GenBank ACW93600.1 345 Sequence 12515 from patent US 7569389
GI:15229905 GenBank ACW94118.1 345 Sequence 13215 from patent US 7569389
GI:15229905 GenBank AED77865.1 345 Sequence 5 from patent US 7915050
GI:15229905 GenBank AED77867.1 345 Sequence 9 from patent US 7915050
GI:15229905 GenBank AEE74188.1 345 putative gibberellin receptor GID1L1 [Arabidopsis thaliana]
GI:15229905 SwissProt Q9MAA7.1 345 RecName: Full=Gibberellin receptor GID1A; AltName: Full=AtCXE10; AltName: Full=Carboxylesterase 10; AltName: Full=GID1-like protein 1; AltName: Full=Protein GA INSENSITIVE DWARF 1A; Short=AtGID1A [Arabidopsis thaliana]

Related Sequences to LMP010379 proteins

Reference Database Accession Length Protein Name
GI:15229905 GenBank EFH58653.1 344 ATGID1A/GID1A [Arabidopsis lyrata subsp. lyrata]
GI:15229905 GenBank ADN93295.1 349 gibberellin receptor 1a [Lepidium sativum]
GI:15229905 GenBank EOA30952.1 345 hypothetical protein CARUB_v10014098mg [Capsella rubella]
GI:15229905 PDB 2ZSH 351 Chain A, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
GI:15229905 PDB 2ZSI 351 Chain A, Structural Basis Of Gibberellin(Ga4)-Induced Della Recognition By The Gibberellin Receptor
GI:15229905 RefSeq XP_006298054.1 345 hypothetical protein CARUB_v10014098mg [Capsella rubella]