Gene/Proteome Database (LMPD)
Proteins
glycerophosphodiester phosphodiesterase | |
---|---|
Refseq ID | NP_177290 |
Protein GI | 42563134 |
UniProt ID | F4I8H8 |
mRNA ID | NM_105803 |
Length | 328 |
RefSeq Status | REVIEWED |
MAIFEWRHRRRPFDGGGTRRRRFFSPLYSRNFKRTILFAVIFLAIFPPLYFHFKLRRIRQIVAQKCDWLHHPPLVCAHGGDSTLAFPNTMDAYSFAIRSRVDCIEVDVSRSSDGVLFALHNRDLQRIARNSSVQVGDLSMKQIKELDVSEIVKGTLGSSRIPTLEEALALISNSVRKVILDAKVGPPMYEKGLAQDILSIIERAQCNNCIVWAKSDTLARDIIRRAPDTMVGYIVMVDPLTGARNSLLRMKGARVVGVYHPLIDEELVRVVRRRNKEVYAWTVDDADPMKRMLHLGVDAVVTSDPSMFQGLMEDLRTECLEEGFSIRT |
Gene Information
Entrez Gene ID
Gene Name
glycerophosphodiester phosphodiesterase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008889 | IEA:InterPro | F | glycerophosphodiester phosphodiesterase activity |
GO:0006071 | IEA:InterPro | P | glycerol metabolic process |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
glycerophosphodiester phosphodiesterase
Protein Entry
GDPD4_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | A glycerophosphodiester + H(2)O = an alcohol + sn-glycerol 3-phosphate. {ECO:0000250|UniProtKB:Q9SGA2}. |
Sequence Caution | Sequence=AAG51889.1; Type=Erroneous gene model prediction; |
Similarity | Belongs to the glycerophosphoryl diester phosphodiesterase family. {ECO:0000305}. |
Similarity | Contains 1 GP-PDE domain. {ECO:0000255}. |
Subcellular Location | Membrane {ECO:0000255}; Single-pass membrane protein {ECO:0000255}. |
Tissue Specificity | Expressed in rosette and cauline leaves. {ECO:0000269|PubMed:21323773}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010421 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
42563134 | RefSeq | NP_177290 | 328 | glycerophosphodiester phosphodiesterase |
Identical Sequences to LMP010421 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:42563134 | GenBank | AEE35191.1 | 328 | glycerophosphodiester phosphodiesterase [Arabidopsis thaliana] |
GI:42563134 | SwissProt | F4I8H8.1 | 328 | RecName: Full=Glycerophosphodiester phosphodiesterase GDPD4; AltName: Full=Glycerophosphodiester phosphodiesterase 4; Short=ATGDPD4 [Arabidopsis thaliana] |
Related Sequences to LMP010421 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:42563134 | GenBank | AAG51889.1 | 349 | unknown protein; 55543-57308 [Arabidopsis thaliana] |
GI:42563134 | GenBank | EFH65090.1 | 329 | glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:42563134 | GenBank | EOA34184.1 | 328 | hypothetical protein CARUB_v10021692mg [Capsella rubella] |
GI:42563134 | RefSeq | XP_002888831.1 | 329 | glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:42563134 | RefSeq | XP_006301286.1 | 328 | hypothetical protein CARUB_v10021692mg [Capsella rubella] |
GI:42563134 | RefSeq | XP_010415839.1 | 328 | PREDICTED: glycerophosphodiester phosphodiesterase GDPD4 isoform X1 [Camelina sativa] |