Gene/Proteome Database (LMPD)

LMPD ID
LMP010453
Gene ID
825532
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
G-protein gamma subunit 2
Gene Symbol
AGG2
Synonyms
G-protein gamma subunit 2
Alternate Names
G-protein gamma subunit 2
Chromosome
3
Summary
heterotrimeric G-protein gamma subunit 2(AGG2)
Orthologs
View orthologs and multiple alignments for AGG2

Proteins

G-protein gamma subunit 2
Refseq ID NP_850746
Protein GI 30695843
UniProt ID Q93V47
mRNA ID NM_180415
Length 100
RefSeq Status REVIEWED
MEAGSSNSSGQLSGRVVDTRGKHRIQAELKRLEQEARFLEEELEQLEKMDNASASCKEFLDSVDSKPDPLLPETTGPVNATWDQWFEGPKEAKRCGCSIL

Gene Information

Entrez Gene ID
825532
Gene Name
G-protein gamma subunit 2
Gene Symbol
AGG2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005834 IDA:UniProtKB C heterotrimeric G-protein complex
GO:0005886 IDA:UniProtKB C plasma membrane
GO:0004871 IEA:UniProtKB-KW F signal transducer activity
GO:0007186 IEA:InterPro P G-protein coupled receptor signaling pathway
GO:0010540 IMP:TAIR P basipetal auxin transport
GO:0048527 IMP:TAIR P lateral root development
GO:0018345 IMP:UniProtKB P protein palmitoylation
GO:0018342 IMP:UniProtKB P protein prenylation
GO:0009845 IMP:TAIR P seed germination

Domain Information

InterPro Annotations

Accession Description
IPR015898 G-protein gamma-like domain

UniProt Annotations

Entry Information

Gene Name
G-protein gamma subunit 2
Protein Entry
GG2_ARATH
UniProt ID
Q93V47
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=1; Comment=Additional isoforms seem to exist.; Name=1; IsoId=Q93V47-1; Sequence=Displayed;
Developmental Stage In seedlings, first observed at the hypocotyl/root junction but later confined to the root, including root hairs. In flowers, expressed in the apex of stamen filaments at a very early developmental stage and disappeared before the flower opened. Not present in siliques. {ECO:0000269|PubMed:17468261, ECO:0000269|PubMed:18441222}.
Disruption Phenotype Hypersensitive to auxin-mediated induction of lateral roots, within the epidermis and/or cortex, attenuating basipetally transported auxin and graviresponsiveness. Enhanced sensitivity to glucose. Abnormal roots architecture. Enhanced susceptibility to necrotrophic and vascular pathogenic fungi, such as Plectosphaerella cucumerina associated with a disturbed expression of genes involved in cell wall metabolism (e.g. lower xylose content in cell walls). {ECO:0000269|PubMed:17468261, ECO:0000269|PubMed:19948787, ECO:0000269|PubMed:20862254, ECO:0000269|PubMed:21980142, ECO:0000269|PubMed:22209167}.
Function Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. Involved in the abscisic acid (ABA) and ethylene signaling pathways. Regulates basipetal transport of auxin (IAA) in roots and hypocotyls, and thus modulates root architecture (e.g. lateral root formation). The heterotrimeric G- protein controls defense responses to necrotrophic and vascular fungi probably by modulating cell wall-related genes expression; involved in resistance to Plectosphaerella cucumerina. {ECO:0000269|PubMed:17383830, ECO:0000269|PubMed:17468261, ECO:0000269|PubMed:19948787, ECO:0000269|PubMed:20862254, ECO:0000269|PubMed:21980142, ECO:0000269|PubMed:22209167}.
Interaction P49177:GB1; NbExp=2; IntAct=EBI-1751115, EBI-1632851;
Similarity Contains 1 G protein gamma domain. {ECO:0000305}.
Subcellular Location Cell membrane {ECO:0000269|PubMed:17158913, ECO:0000269|PubMed:17220359, ECO:0000269|PubMed:22068106}. Note=Localized to the cell membrane when attached to beta subunit GB1.
Subunit G proteins are composed of 3 units, alpha, beta and gamma. GPG1 interacts with the beta subunit GB1. The dimer GB1-GG2 interacts with NDL1, NDL2 and NDL3. Binds to NUDT7. {ECO:0000269|PubMed:11513956, ECO:0000269|PubMed:17158913, ECO:0000269|PubMed:17468261, ECO:0000269|PubMed:19948787, ECO:0000269|PubMed:22068106}.
Tissue Specificity Mostly expressed in roots (excluded from the stele), seedlings (especially at the hypocotyl/root junction), floral stems, floral buds, flowers and siliques, and, to a lower extent, in leaves (restricted to guard cells). Also present in hydathods. {ECO:0000269|PubMed:11513956, ECO:0000269|PubMed:17468261, ECO:0000269|PubMed:18441222}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010453 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30695843 RefSeq NP_850746 100 G-protein gamma subunit 2

Identical Sequences to LMP010453 proteins

Reference Database Accession Length Protein Name
GI:30695843 DBBJ BAF00249.1 100 hypothetical protein [Arabidopsis thaliana]
GI:30695843 GenBank AAK71536.1 100 heterotrimeric G-protein gamma subunit 2 [Arabidopsis thaliana]
GI:30695843 GenBank AAK71537.1 100 heterotrimeric G-protein gamma subunit 2 [Arabidopsis thaliana]
GI:30695843 GenBank ABD57482.1 100 At3g22942 [Arabidopsis thaliana]
GI:30695843 GenBank AEE76694.1 100 G-protein gamma subunit 2 [Arabidopsis thaliana]
GI:30695843 SwissProt Q93V47.1 100 RecName: Full=Guanine nucleotide-binding protein subunit gamma 2; AltName: Full=Ggamma-subunit 2; AltName: Full=Heterotrimeric G protein gamma-subunit 2; Short=AtAGG2; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010453 proteins

Reference Database Accession Length Protein Name
GI:30695843 GenBank EFH59644.1 100 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:30695843 GenBank ESQ47562.1 100 hypothetical protein EUTSA_v10021823mg [Eutrema salsugineum]
GI:30695843 GenBank KFK39576.1 100 hypothetical protein AALP_AA3G262200 [Arabis alpina]
GI:30695843 RefSeq XP_002883385.1 100 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:30695843 RefSeq XP_006406109.1 100 hypothetical protein EUTSA_v10021823mg [Eutrema salsugineum]
GI:30695843 RefSeq XP_010488328.1 100 PREDICTED: guanine nucleotide-binding protein subunit gamma 2 [Camelina sativa]