Gene/Proteome Database (LMPD)
Proteins
| Lecithin-cholesterol acyltransferase-like 1 | |
|---|---|
| Refseq ID | NP_564286 |
| Protein GI | 18396359 |
| UniProt ID | Q9FZI8 |
| mRNA ID | NM_102512 |
| Length | 432 |
| RefSeq Status | REVIEWED |
| MKKISSHYSVVIAILVVVTMTSMCQAVGSNVYPLILVPGNGGNQLEVRLDREYKPSSVWCSSWLYPIHKKSGGWFRLWFDAAVLLSPFTRCFSDRMMLYYDPDLDDYQNAPGVQTRVPHFGSTKSLLYLDPRLRDATSYMEHLVKALEKKCGYVNDQTILGAPYDFRYGLAASGHPSRVASQFLQDLKQLVEKTSSENEGKPVILLSHSLGGLFVLHFLNRTTPSWRRKYIKHFVALAAPWGGTISQMKTFASGNTLGVPLVNPLLVRRHQRTSESNQWLLPSTKVFHDRTKPLVVTPQVNYTAYEMDRFFADIGFSQGVVPYKTRVLPLTEELMTPGVPVTCIYGRGVDTPEVLMYGKGGFDKQPEIKYGDGDGTVNLASLAALKVDSLNTVEIDGVSHTSILKDEIALKEIMKQISIINYELANVNAVNE | |
Gene Information
Entrez Gene ID
Gene Name
Lecithin-cholesterol acyltransferase-like 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005774 | IDA:TAIR | C | vacuolar membrane |
| GO:0005773 | IDA:TAIR | C | vacuole |
| GO:0008374 | IEA:InterPro | F | O-acyltransferase activity |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
Lecithin-cholesterol acyltransferase-like 1
Protein Entry
LCAT1_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the AB hydrolase superfamily. Lipase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010527 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18396359 | RefSeq | NP_564286 | 432 | Lecithin-cholesterol acyltransferase-like 1 |
Identical Sequences to LMP010527 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18396359 | GenBank | ABN27775.1 | 432 | Sequence 3 from patent US 7157619 |
| GI:18396359 | GenBank | ACK01981.1 | 432 | Sequence 14 from patent US 7427593 |
| GI:18396359 | GenBank | ACP74345.1 | 432 | Sequence 11 from patent US 7498026 |
| GI:18396359 | GenBank | ADA08778.1 | 432 | Sequence 3 from patent US 7601890 |
| GI:18396359 | GenBank | ADC16986.1 | 432 | Sequence 14 from patent US 7635582 |
| GI:18396359 | GenBank | AEE30837.1 | 432 | Lecithin-cholesterol acyltransferase-like 1 [Arabidopsis thaliana] |
Related Sequences to LMP010527 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18396359 | GenBank | ACK01983.1 | 387 | Sequence 16 from patent US 7427593 |
| GI:18396359 | GenBank | ADC16989.1 | 387 | Sequence 17 from patent US 7635582 |
| GI:18396359 | GenBank | EFH66989.1 | 432 | lecithin:cholesterol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18396359 | RefSeq | XP_002890730.1 | 432 | lecithin:cholesterol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18396359 | RefSeq | XP_010499228.1 | 433 | PREDICTED: lecithin-cholesterol acyltransferase-like 1 [Camelina sativa] |
| GI:18396359 | RefSeq | XP_010478088.1 | 433 | PREDICTED: lecithin-cholesterol acyltransferase-like 1 [Camelina sativa] |