Gene/Proteome Database (LMPD)

LMPD ID
LMP010527
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Lecithin-cholesterol acyltransferase-like 1
Gene Symbol
Synonyms
F17L21.27; F17L21_27
Alternate Names
Lecithin-cholesterol acyltransferase-like 1
Chromosome
1
EC Number
2.3.1.-

Proteins

Lecithin-cholesterol acyltransferase-like 1
Refseq ID NP_564286
Protein GI 18396359
UniProt ID Q9FZI8
mRNA ID NM_102512
Length 432
RefSeq Status REVIEWED
MKKISSHYSVVIAILVVVTMTSMCQAVGSNVYPLILVPGNGGNQLEVRLDREYKPSSVWCSSWLYPIHKKSGGWFRLWFDAAVLLSPFTRCFSDRMMLYYDPDLDDYQNAPGVQTRVPHFGSTKSLLYLDPRLRDATSYMEHLVKALEKKCGYVNDQTILGAPYDFRYGLAASGHPSRVASQFLQDLKQLVEKTSSENEGKPVILLSHSLGGLFVLHFLNRTTPSWRRKYIKHFVALAAPWGGTISQMKTFASGNTLGVPLVNPLLVRRHQRTSESNQWLLPSTKVFHDRTKPLVVTPQVNYTAYEMDRFFADIGFSQGVVPYKTRVLPLTEELMTPGVPVTCIYGRGVDTPEVLMYGKGGFDKQPEIKYGDGDGTVNLASLAALKVDSLNTVEIDGVSHTSILKDEIALKEIMKQISIINYELANVNAVNE

Gene Information

Entrez Gene ID
Gene Name
Lecithin-cholesterol acyltransferase-like 1
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005774 IDA:TAIR C vacuolar membrane
GO:0005773 IDA:TAIR C vacuole
GO:0008374 IEA:InterPro F O-acyltransferase activity
GO:0006629 IEA:InterPro P lipid metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
6254126 HDL-mediated lipid transport
6253965 Lipid digestion, mobilization, and transport
6254127 Lipoprotein metabolism
6253725 Metabolism of lipids and lipoproteins

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR003386 Lecithin:cholesterol/phospholipid:diacylglycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
Lecithin-cholesterol acyltransferase-like 1
Protein Entry
LCAT1_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Similarity Belongs to the AB hydrolase superfamily. Lipase family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010527 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18396359 RefSeq NP_564286 432 Lecithin-cholesterol acyltransferase-like 1

Identical Sequences to LMP010527 proteins

Reference Database Accession Length Protein Name
GI:18396359 GenBank ABN27775.1 432 Sequence 3 from patent US 7157619
GI:18396359 GenBank ACK01981.1 432 Sequence 14 from patent US 7427593
GI:18396359 GenBank ACP74345.1 432 Sequence 11 from patent US 7498026
GI:18396359 GenBank ADA08778.1 432 Sequence 3 from patent US 7601890
GI:18396359 GenBank ADC16986.1 432 Sequence 14 from patent US 7635582
GI:18396359 GenBank AEE30837.1 432 Lecithin-cholesterol acyltransferase-like 1 [Arabidopsis thaliana]

Related Sequences to LMP010527 proteins

Reference Database Accession Length Protein Name
GI:18396359 GenBank ACK01983.1 387 Sequence 16 from patent US 7427593
GI:18396359 GenBank ADC16989.1 387 Sequence 17 from patent US 7635582
GI:18396359 GenBank EFH66989.1 432 lecithin:cholesterol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata]
GI:18396359 RefSeq XP_002890730.1 432 lecithin:cholesterol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata]
GI:18396359 RefSeq XP_010499228.1 433 PREDICTED: lecithin-cholesterol acyltransferase-like 1 [Camelina sativa]
GI:18396359 RefSeq XP_010478088.1 433 PREDICTED: lecithin-cholesterol acyltransferase-like 1 [Camelina sativa]