Gene/Proteome Database (LMPD)
Proteins
Lecithin-cholesterol acyltransferase-like 1 | |
---|---|
Refseq ID | NP_564286 |
Protein GI | 18396359 |
UniProt ID | Q9FZI8 |
mRNA ID | NM_102512 |
Length | 432 |
RefSeq Status | REVIEWED |
MKKISSHYSVVIAILVVVTMTSMCQAVGSNVYPLILVPGNGGNQLEVRLDREYKPSSVWCSSWLYPIHKKSGGWFRLWFDAAVLLSPFTRCFSDRMMLYYDPDLDDYQNAPGVQTRVPHFGSTKSLLYLDPRLRDATSYMEHLVKALEKKCGYVNDQTILGAPYDFRYGLAASGHPSRVASQFLQDLKQLVEKTSSENEGKPVILLSHSLGGLFVLHFLNRTTPSWRRKYIKHFVALAAPWGGTISQMKTFASGNTLGVPLVNPLLVRRHQRTSESNQWLLPSTKVFHDRTKPLVVTPQVNYTAYEMDRFFADIGFSQGVVPYKTRVLPLTEELMTPGVPVTCIYGRGVDTPEVLMYGKGGFDKQPEIKYGDGDGTVNLASLAALKVDSLNTVEIDGVSHTSILKDEIALKEIMKQISIINYELANVNAVNE |
Gene Information
Entrez Gene ID
Gene Name
Lecithin-cholesterol acyltransferase-like 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005774 | IDA:TAIR | C | vacuolar membrane |
GO:0005773 | IDA:TAIR | C | vacuole |
GO:0008374 | IEA:InterPro | F | O-acyltransferase activity |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
Lecithin-cholesterol acyltransferase-like 1
Protein Entry
LCAT1_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Similarity | Belongs to the AB hydrolase superfamily. Lipase family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010527 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
18396359 | RefSeq | NP_564286 | 432 | Lecithin-cholesterol acyltransferase-like 1 |
Identical Sequences to LMP010527 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18396359 | GenBank | ABN27775.1 | 432 | Sequence 3 from patent US 7157619 |
GI:18396359 | GenBank | ACK01981.1 | 432 | Sequence 14 from patent US 7427593 |
GI:18396359 | GenBank | ACP74345.1 | 432 | Sequence 11 from patent US 7498026 |
GI:18396359 | GenBank | ADA08778.1 | 432 | Sequence 3 from patent US 7601890 |
GI:18396359 | GenBank | ADC16986.1 | 432 | Sequence 14 from patent US 7635582 |
GI:18396359 | GenBank | AEE30837.1 | 432 | Lecithin-cholesterol acyltransferase-like 1 [Arabidopsis thaliana] |
Related Sequences to LMP010527 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18396359 | GenBank | ACK01983.1 | 387 | Sequence 16 from patent US 7427593 |
GI:18396359 | GenBank | ADC16989.1 | 387 | Sequence 17 from patent US 7635582 |
GI:18396359 | GenBank | EFH66989.1 | 432 | lecithin:cholesterol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18396359 | RefSeq | XP_002890730.1 | 432 | lecithin:cholesterol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18396359 | RefSeq | XP_010499228.1 | 433 | PREDICTED: lecithin-cholesterol acyltransferase-like 1 [Camelina sativa] |
GI:18396359 | RefSeq | XP_010478088.1 | 433 | PREDICTED: lecithin-cholesterol acyltransferase-like 1 [Camelina sativa] |