Gene/Proteome Database (LMPD)

LMPD ID
LMP010545
Gene ID
824256
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphatidic acid phosphatase (PAP2) family protein
Gene Symbol
AT3G50920
Alternate Names
phosphatidic acid phosphatase (PAP2) family protein
Chromosome
3
EC Number
3.1.3.-

Proteins

phosphatidic acid phosphatase (PAP2) family protein
Refseq ID NP_190661
Protein GI 42565815
UniProt ID F4J220
mRNA ID NM_114952
Length 279
RefSeq Status REVIEWED
MAASSSLLLLLHCPTCNFYFDSSSYLKRSRLSSYSSIISRGSPLFVSSFGSMTVKRFSSRVGSRSNDGNEQFGALEQESFINNSSEIRKDLVTGGGIEAIVNRLSKWVVSVLFGSIILLRHDGAALWAVIGSISNSALSVVLKRILNQERPTTTLRSDPGMPSSHAQSISFISVFAVLSVMEWLGTNGVSLFLSGLILALGSYFIRLRVSQKLHTSSQVVVGAIVGSLFCILWYTMWNSLLREAFEASLLVQISVFLFAATFALAFAAYVVLNWFKDER
phosphatidic acid phosphatase (PAP2) family protein
Refseq ID NP_001030835
Protein GI 79314709
UniProt ID F4J220
mRNA ID NM_001035758
Length 228
RefSeq Status REVIEWED
MTVKRFSSRVGSRSNDGNEQFGALEQESFINNSSEIRKDLVTGGGIEAIVNRLSKWVVSVLFGSIILLRHDGAALWAVIGSISNSALSVVLKRILNQERPTTTLRSDPGMPSSHAQSISFISVFAVLSVMEWLGTNGVSLFLSGLILALGSYFIRLRVSQKLHTSSQVVVGAIVGSLFCILWYTMWNSLLREAFEASLLVQISVFLFAATFALAFAAYVVLNWFKDER

Gene Information

Entrez Gene ID
824256
Gene Name
phosphatidic acid phosphatase (PAP2) family protein
Gene Symbol
AT3G50920
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0009528 IEA:UniProtKB-KW C plastid inner membrane
GO:0008195 IDA:TAIR F phosphatidate phosphatase activity
GO:0016311 IDA:GOC P dephosphorylation
GO:0006651 IDA:TAIR P diacylglycerol biosynthetic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
TRIGLSYN-PWY triacylglycerol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR000326 Phosphatidic acid phosphatase type 2/haloperoxidase

UniProt Annotations

Entry Information

Gene Name
phosphatidic acid phosphatase (PAP2) family protein
Protein Entry
LPPE1_ARATH
UniProt ID
F4J220
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=F4J220-1; Sequence=Displayed; Name=2; IsoId=F4J220-2; Sequence=VSP_053603; Note=No experimental confirmation available.;
Biophysicochemical Properties pH dependence: Optimum pH is 7.0. {ECO:0000269|PubMed:17652095};
Disruption Phenotype No visible phenotype under normal growth conditions. {ECO:0000269|PubMed:17652095}.
Enzyme Regulation Inhibited by Mg(2+). {ECO:0000269|PubMed:17652095}.
Function Exhibits phosphatidate phosphatase (PAP) activity in vitro. May play a secondary role as PAP in plastids. {ECO:0000269|PubMed:17652095}.
Similarity Belongs to the PA-phosphatase related phosphoesterase family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast inner membrane {ECO:0000305|PubMed:17652095}; Multi-pass membrane protein {ECO:0000305|PubMed:17652095}.
Tissue Specificity Expressed in root tips, root branch points, cotyledons and leaves. {ECO:0000269|PubMed:17652095}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010545 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
42565815 RefSeq NP_190661 279 phosphatidic acid phosphatase (PAP2) family protein
79314709 RefSeq NP_001030835 228 phosphatidic acid phosphatase (PAP2) family protein

Identical Sequences to LMP010545 proteins

Reference Database Accession Length Protein Name
GI:79314709 DBBJ BAD44499.1 228 putative protein [Arabidopsis thaliana]
GI:79314709 EMBL CAB42921.1 228 putative protein [Arabidopsis thaliana]
GI:79314709 GenBank AAR24678.1 228 At3g50920 [Arabidopsis thaliana]
GI:42565815 GenBank AEE78725.1 279 phosphatidic acid phosphatase (PAP2) family protein [Arabidopsis thaliana]
GI:79314709 GenBank AEE78726.1 228 phosphatidic acid phosphatase (PAP2) family protein [Arabidopsis thaliana]
GI:42565815 SwissProt F4J220.1 279 RecName: Full=Lipid phosphate phosphatase epsilon 1, chloroplastic; Short=AtLPPE1; AltName: Full=Phosphatidic acid phosphatase epsilon 1; AltName: Full=Plastidic phosphatidic acid phosphatase epsilon 1; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010545 proteins

Reference Database Accession Length Protein Name
GI:42565815 DBBJ BAD44499.1 228 putative protein [Arabidopsis thaliana]
GI:42565815 GenBank AAR24678.1 228 At3g50920 [Arabidopsis thaliana]
GI:42565815 GenBank EFH54039.1 278 hypothetical protein ARALYDRAFT_485445 [Arabidopsis lyrata subsp. lyrata]
GI:79314709 GenBank EFH54039.1 278 hypothetical protein ARALYDRAFT_485445 [Arabidopsis lyrata subsp. lyrata]
GI:79314709 GenBank AEE78725.1 279 phosphatidic acid phosphatase (PAP2) family protein [Arabidopsis thaliana]
GI:42565815 GenBank AEE78726.1 228 phosphatidic acid phosphatase (PAP2) family protein [Arabidopsis thaliana]
GI:79314709 RefSeq NP_190661.2 279 phosphatidic acid phosphatase (PAP2) family protein [Arabidopsis thaliana]
GI:42565815 RefSeq NP_001030835.1 228 phosphatidic acid phosphatase (PAP2) family protein [Arabidopsis thaliana]
GI:79314709 RefSeq XP_002877780.1 278 hypothetical protein ARALYDRAFT_485445 [Arabidopsis lyrata subsp. lyrata]
GI:42565815 RefSeq XP_002877780.1 278 hypothetical protein ARALYDRAFT_485445 [Arabidopsis lyrata subsp. lyrata]
GI:79314709 RefSeq XP_006291804.1 225 hypothetical protein CARUB_v10017980mg [Capsella rubella]
GI:79314709 SwissProt F4J220.1 279 RecName: Full=Lipid phosphate phosphatase epsilon 1, chloroplastic; Short=AtLPPE1; AltName: Full=Phosphatidic acid phosphatase epsilon 1; AltName: Full=Plastidic phosphatidic acid phosphatase epsilon 1; Flags: Precursor [Arabidopsis thaliana]