Gene/Proteome Database (LMPD)
LMPD ID
LMP010553
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
dihydrolipoamide branched chain acyltransferase
Gene Symbol
Synonyms
DARK INDUCIBLE 3; DIN3; LTA1
Alternate Names
dihydrolipoamide branched chain acyltransferase
Chromosome
3
EC Number
2.3.1.168
Summary
dihydrolipoamide branched chain acyltransferase
Orthologs
Proteins
| dihydrolipoamide branched chain acyltransferase | |
|---|---|
| Refseq ID | NP_187341 |
| Protein GI | 15231314 |
| UniProt ID | Q9M7Z1 |
| mRNA ID | NM_111565 |
| Length | 483 |
| RefSeq Status | REVIEWED |
| MIARRIWRSHRFLRPFSSSSVCSPPFRVPEYLSQSSSSPASRPFFVHPPTLMKWGGGSRSWFSNEAMATDSNSGLIDVPLAQTGEGIAECELLKWFVKEGDSVEEFQPLCEVQSDKATIEITSRFKGKVALISHSPGDIIKVGETLVRLAVEDSQDSLLTTDSSEIVTLGGSKQGTENLLGALSTPAVRNLAKDLGIDINVITGTGKDGRVLKEDVLRFSDQKGFVTDSVSSEHAVIGGDSVSTKASSNFEDKTVPLRGFSRAMVKTMTMATSVPHFHFVEEINCDSLVELKQFFKENNTDSTIKHTFLPTLIKSLSMALTKYPFVNSCFNAESLEIILKGSHNIGVAMATEHGLVVPNIKNVQSLSLLEITKELSRLQHLAANNKLNPEDVTGGTITLSNIGAIGGKFGSPLLNLPEVAIIALGRIEKVPKFSKEGTVYPASIMMVNIAADHRVLDGATVARFCCQWKEYVEKPELLMLQMR | |
Gene Information
Entrez Gene ID
Gene Name
dihydrolipoamide branched chain acyltransferase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IDA:TAIR | C | mitochondrion |
| GO:0016407 | IDA:TAIR | F | acetyltransferase activity |
| GO:0004147 | TAS:TAIR | F | dihydrolipoamide branched chain acyltransferase activity |
| GO:0043754 | IEA:UniProtKB-EC | F | dihydrolipoyllysine-residue (2-methylpropanoyl)transferase activity |
| GO:0008270 | IDA:TAIR | F | zinc ion binding |
| GO:0043617 | IEP:UniProtKB | P | cellular response to sucrose starvation |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
| GO:0009646 | IEP:UniProtKB | P | response to absence of light |
| GO:0009744 | IEP:UniProtKB | P | response to sucrose |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01110 | Biosynthesis of secondary metabolites |
| ath_M00036 | Leucine degradation, leucine => acetoacetate + acetyl-CoA |
| ath01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6253683 | Branched-chain amino acid catabolism |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001078 | 2-oxoacid dehydrogenase acyltransferase, catalytic domain |
| IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site |
| IPR000089 | Biotin/lipoyl attachment |
| IPR023213 | Chloramphenicol acetyltransferase-like domain |
| IPR004167 | E3-binding domain |
| IPR015761 | Lipoamide Acyltransferase |
| IPR011053 | Single hybrid motif |
UniProt Annotations
Entry Information
Gene Name
dihydrolipoamide branched chain acyltransferase
Protein Entry
ODB2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2-methylpropanoyl-CoA + enzyme N(6)- (dihydrolipoyl)lysine = CoA + enzyme N(6)-(S-(2- methylpropanoyl)dihydrolipoyl)lysine. |
| Cofactor | Name=(R)-lipoate; Xref=ChEBI:CHEBI:83088; Evidence={ECO:0000250}; Note=Binds 1 lipoyl cofactor covalently. {ECO:0000250}; |
| Developmental Stage | Barely detected in non senescent green leaves, accumulated slightly at the early stage of leaf senescence and strongly expressed at the late stage of leaf senescence. {ECO:0000269|PubMed:10681595}. |
| Function | The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3). Within this complex, the catalytic function of this enzyme is to accept, and to transfer to coenzyme A, acyl groups that are generated by the branched-chain alpha-keto acid decarboxylase component (By similarity). Required during sugar starvation and acts under the control of a sugar-sensing mechanism involving Ser/Thr kinases and phosphatases. {ECO:0000250, ECO:0000269|PubMed:11080291, ECO:0000269|PubMed:11917081}. |
| Induction | By dark treatment (at the protein level). Induced by the calmodulin antagonists trifluoperazine and fluphenazine in darkness. Down-regulated by sucrose in a hexokinase dependent manner (at protein level). Up-regulated by Leucine and its derivative alpha-keto acid (KIC). {ECO:0000269|PubMed:10681595, ECO:0000269|PubMed:11080291, ECO:0000269|PubMed:11418132, ECO:0000269|PubMed:11917081, ECO:0000269|PubMed:16100230}. |
| Similarity | Belongs to the 2-oxoacid dehydrogenase family. {ECO:0000305}. |
| Similarity | Contains 1 E3-binding domain. {ECO:0000305}. |
| Similarity | Contains 1 lipoyl-binding domain. {ECO:0000255|PROSITE-ProRule:PRU01066, ECO:0000305}. |
| Subcellular Location | Mitochondrion matrix {ECO:0000269|PubMed:14671022, ECO:0000269|PubMed:14764908}. |
| Subunit | Forms a 24-polypeptide structural core with octahedral symmetry. {ECO:0000269|PubMed:10933498}. |
| Tissue Specificity | Expressed in the non-photosynthetic organs such as siliques, flowers and roots. {ECO:0000269|PubMed:10681595}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010553 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15231314 | RefSeq | NP_187341 | 483 | dihydrolipoamide branched chain acyltransferase |
Identical Sequences to LMP010553 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15231314 | DBBJ | BAH19487.1 | 483 | AT3G06850 [Arabidopsis thaliana] |
| GI:15231314 | DBBJ | BAH20078.1 | 483 | AT3G06850 [Arabidopsis thaliana] |
| GI:15231314 | GenBank | AEE74466.1 | 483 | dihydrolipoamide branched chain acyltransferase [Arabidopsis thaliana] |
| GI:15231314 | GenBank | AEE74467.1 | 483 | dihydrolipoamide branched chain acyltransferase [Arabidopsis thaliana] |
| GI:15231314 | RefSeq | NP_850527.1 | 483 | dihydrolipoamide branched chain acyltransferase [Arabidopsis thaliana] |
| GI:15231314 | SwissProt | Q9M7Z1.1 | 483 | RecName: Full=Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial; AltName: Full=Branched-chain alpha-keto acid dehydrogenase complex component E2; Short=BCE2; Short=BCKAD-E2; Short=BCKADE2; AltName: Full=Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; AltName: Full=Dihydrolipoamide branched chain transacylase; AltName: Full=Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase; AltName: Full=Protein DARK INDUCIBLE 3; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010553 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15231314 | DBBJ | BAH57200.1 | 455 | AT3G06850 [Arabidopsis thaliana] |
| GI:15231314 | GenBank | AAC16694.1 | 483 | dihydrolipoylacyltransferase subunit of the branched-chain alpha-keto acid dehydrogenase complex [Arabidopsis thaliana] |
| GI:15231314 | GenBank | AAF35280.1 | 483 | branched chain alpha-keto acid dehydrogenase E2 subunit [Arabidopsis thaliana] |
| GI:15231314 | GenBank | AAW00651.1 | 483 | Sequence 16 from patent US 6773917 |
| GI:15231314 | GenBank | EFH60871.1 | 484 | DIN3/LTA1 [Arabidopsis lyrata subsp. lyrata] |
| GI:15231314 | RefSeq | XP_002884612.1 | 484 | DIN3/LTA1 [Arabidopsis lyrata subsp. lyrata] |