Gene/Proteome Database (LMPD)
Proteins
LORELEI-like-GPI anchored protein 3 | |
---|---|
Refseq ID | NP_194557 |
Protein GI | 79487647 |
UniProt ID | Q6NMM2 |
mRNA ID | NM_118968 |
Length | 134 |
RefSeq Status | REVIEWED |
MIISLISKIFHDHYVNDILTACKEDFAAKNYTIITSKCKGPNYPAKVCCSAFKDFACPFAEVLNDEKTDCASTMFSYINLYGRYPPGIFANMCKEGKEGLDCTDVTPTSSSHASIPLVSTHVLLITVSILFHLF |
LORELEI-like-GPI anchored protein 3 | |
---|---|
Refseq ID | NP_001190858 |
Protein GI | 334186994 |
UniProt ID | Q9M0I0 |
mRNA ID | NM_001203929 |
Length | 160 |
RefSeq Status | REVIEWED |
MKITHHCLVSLLSILLLSGFAFSHHISLDEFESHPSTSRALLQAKATCKEDFAAKNYTIITSKCKGPNYPAKVCCSAFKDFACPFAEVLNDEKTDCASTMFSYINLYGRYPPGIFANMCKEGKEGLDCTDVTPTSSSHASIPLVSTHVLLITVSILFHLF |
Gene Information
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Gene Name
LORELEI-like-GPI anchored protein 3
Protein Entry
Q9M0I0_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP010578 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
334186994 | RefSeq | NP_001190858 | 160 | LORELEI-like-GPI anchored protein 3 |
79487647 | RefSeq | NP_194557 | 134 | LORELEI-like-GPI anchored protein 3 |
Identical Sequences to LMP010578 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:334186994 | EMBL | CAB79630.1 | 160 | putative GPI-anchored protein [Arabidopsis thaliana] |
GI:79487647 | GenBank | AAR24700.1 | 134 | At4g28280 [Arabidopsis thaliana] |
GI:79487647 | GenBank | AAS47641.1 | 134 | At4g28280 [Arabidopsis thaliana] |
GI:79487647 | GenBank | AEE85463.1 | 134 | LORELEI-like-GPI anchored protein 3 [Arabidopsis thaliana] |
GI:334186994 | GenBank | AEE85464.1 | 160 | LORELEI-like-GPI anchored protein 3 [Arabidopsis thaliana] |
Related Sequences to LMP010578 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:79487647 | EMBL | CAB79630.1 | 160 | putative GPI-anchored protein [Arabidopsis thaliana] |
GI:334186994 | EMBL | CDX89190.1 | 159 | BnaA01g17030D [Brassica napus] |
GI:79487647 | GenBank | EFH45771.1 | 126 | hypothetical protein ARALYDRAFT_491945 [Arabidopsis lyrata subsp. lyrata] |
GI:79487647 | GenBank | AEE85464.1 | 160 | LORELEI-like-GPI anchored protein 3 [Arabidopsis thaliana] |
GI:334186994 | GenBank | EOA17504.1 | 183 | hypothetical protein CARUB_v10005837mg [Capsella rubella] |
GI:79487647 | GenBank | EOA17504.1 | 183 | hypothetical protein CARUB_v10005837mg [Capsella rubella] |
GI:334186994 | GenBank | KFK35897.1 | 160 | hypothetical protein AALP_AA4G050600 [Arabis alpina] |
GI:79487647 | RefSeq | XP_002869512.1 | 126 | hypothetical protein ARALYDRAFT_491945 [Arabidopsis lyrata subsp. lyrata] |
GI:79487647 | RefSeq | NP_001190858.1 | 160 | LORELEI-like-GPI anchored protein 3 [Arabidopsis thaliana] |
GI:334186994 | RefSeq | XP_006284606.1 | 183 | hypothetical protein CARUB_v10005837mg [Capsella rubella] |
GI:334186994 | RefSeq | XP_010438482.1 | 161 | PREDICTED: GPI-anchored protein LORELEI-like [Camelina sativa] |
GI:334186994 | RefSeq | XP_010448003.1 | 162 | PREDICTED: GPI-anchored protein LORELEI-like [Camelina sativa] |