Gene/Proteome Database (LMPD)

LMPD ID
LMP010601
Gene ID
836066
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
mannose-P-dolichol utilization defect 1 protein
Gene Symbol
AT5G59470
Synonyms
F2O15.15; F2O15_15
Alternate Names
mannose-P-dolichol utilization defect 1 protein
Chromosome
5

Proteins

mannose-P-dolichol utilization defect 1 protein
Refseq ID NP_001190569
Protein GI 334188492
UniProt ID Q9LTI3
mRNA ID NM_001203640
Length 148
RefSeq Status REVIEWED
MDYLGIDLSCAIGSLRNGEFPAKDCLLPLISKLLGYFLVAASMTVKLPQIMKIVDNKSVKGLSVVAFELEVIGYTISLAYCLNKDLPFSAFGELAFLLIQALILVACIYYFSQPLSVTTWVKAILYFAIAPTVFADLEELQKQKHWTT
mannose-P-dolichol utilization defect 1 protein
Refseq ID NP_200755
Protein GI 15238425
UniProt ID Q9LTI3
mRNA ID NM_125338
Length 239
RefSeq Status REVIEWED
MDYLGIDLSCAIGSLRNGEFPAKDCLLPLISKLLGYFLVAASMTVKLPQIMKIVDNKSVKGLSVVAFELEVIGYTISLAYCLNKDLPFSAFGELAFLLIQALILVACIYYFSQPLSVTTWVKAILYFAIAPTVFAGKIDPFLFEALYASKHLIFLSARIPQIWKNFRNKSTGQLSFLTCLMNFGGALARVFTSIQEKAPLSMLLGIVLSIFTNGIIMSQILLYRSKGNEDKLVKSKKIS

Gene Information

Entrez Gene ID
836066
Gene Name
mannose-P-dolichol utilization defect 1 protein
Gene Symbol
AT5G59470
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0006810 IEA:UniProtKB-KW P transport

REACTOME Pathway Links

REACTOME Pathway ID Description
6254040 Asparagine N-linked glycosylation
6254039 Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
6253709 Metabolism of proteins
6253957 Post-translational protein modification

Domain Information

InterPro Annotations

Accession Description
IPR016817 Mannose-P-dolichol utilization defect 1 protein
IPR006603 PQ-loop repeat

UniProt Annotations

Entry Information

Gene Name
mannose-P-dolichol utilization defect 1 protein
Protein Entry
MPU11_ARATH
UniProt ID
Q9LTI3
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9LTI3-1; Sequence=Displayed; Name=2; IsoId=Q9LTI3-2; Sequence=VSP_038060, VSP_038061;
Similarity Belongs to the MPDU1 (TC 2.A.43.3) family. {ECO:0000305}.
Similarity Contains 2 PQ-loop domains. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010601 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15238425 RefSeq NP_200755 239 mannose-P-dolichol utilization defect 1 protein
334188492 RefSeq NP_001190569 148 mannose-P-dolichol utilization defect 1 protein

Identical Sequences to LMP010601 proteins

Reference Database Accession Length Protein Name
GI:334188492 DBBJ BAC42640.1 148 unknown protein [Arabidopsis thaliana]
GI:15238425 EMBL CAW93964.1 239 unnamed protein product [Arabidopsis thaliana]
GI:15238425 EMBL CBD02995.1 239 unnamed protein product [Arabidopsis thaliana]
GI:15238425 EMBL CBD07949.1 239 unnamed protein product [Arabidopsis thaliana]
GI:15238425 EMBL CBC95875.1 239 unnamed protein product [Arabidopsis thaliana]
GI:15238425 EMBL CBC97519.1 239 unnamed protein product [Arabidopsis thaliana]
GI:334188492 GenBank AAO39892.1 148 At5g59470 [Arabidopsis thaliana]
GI:15238425 gnl TAIR 239 mannose-P-dolichol utilization defect 1 protein [Arabidopsis thaliana]
GI:334188492 gnl TAIR 148 mannose-P-dolichol utilization defect 1 protein [Arabidopsis thaliana]

Related Sequences to LMP010601 proteins

Reference Database Accession Length Protein Name
GI:334188492 EMBL CBD02995.1 239 unnamed protein product [Arabidopsis thaliana]
GI:334188492 EMBL CBD07949.1 239 unnamed protein product [Arabidopsis thaliana]
GI:334188492 EMBL CBC95875.1 239 unnamed protein product [Arabidopsis thaliana]
GI:334188492 EMBL CBC97519.1 239 unnamed protein product [Arabidopsis thaliana]
GI:15238425 GenBank EFH40896.1 239 PQ-loop repeat family protein [Arabidopsis lyrata subsp. lyrata]
GI:15238425 GenBank EOA13914.1 239 hypothetical protein CARUB_v10027032mg [Capsella rubella]
GI:15238425 GenBank ESQ42409.1 239 hypothetical protein EUTSA_v10015267mg [Eutrema salsugineum]
GI:15238425 RefSeq XP_002864637.1 239 PQ-loop repeat family protein [Arabidopsis lyrata subsp. lyrata]
GI:15238425 RefSeq XP_006281016.1 239 hypothetical protein CARUB_v10027032mg [Capsella rubella]
GI:15238425 RefSeq XP_006400956.1 239 hypothetical protein EUTSA_v10015267mg [Eutrema salsugineum]
GI:334188492 RefSeq XP_010483580.1 148 PREDICTED: mannose-P-dolichol utilization defect 1 protein homolog 1-like isoform X2 [Camelina sativa]
GI:334188492 SwissProt Q9LTI3.1 239 RecName: Full=Mannose-P-dolichol utilization defect 1 protein homolog 1 [Arabidopsis thaliana]