Gene/Proteome Database (LMPD)
Proteins
mannose-P-dolichol utilization defect 1 protein | |
---|---|
Refseq ID | NP_567315 |
Protein GI | 18412994 |
UniProt ID | Q8VY63 |
mRNA ID | NM_116811 |
Length | 235 |
RefSeq Status | REVIEWED |
MDYLGIDMSCAIGSLRNGDFPEKDCLLPLISKLLGYCLVAASITVKLPQIMKIVQHKSVRGLSVVAFELEVVGYTISLAYCLHKGLPFSAFGEMAFLLIQALILVACIYYYSQPVPVTTWIRPLLYCAVAPTVLAGQINPTLFEALYASQHAIFLFARLPQIWKNFKNKSTGELSFLTFFMNFAGSIVRVFTSLQEKAPISILTGFALGVVTNGSILTQILLYSKPAAAKEKKAN |
Gene Information
Entrez Gene ID
Gene Name
mannose-P-dolichol utilization defect 1 protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0006810 | IEA:UniProtKB-KW | P | transport |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
mannose-P-dolichol utilization defect 1 protein
Protein Entry
MPU12_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Function | Required for normal utilization of mannose-dolichol phosphate (Dol-P-Man) in the synthesis of N-linked and O-linked oligosaccharides and GPI anchors. {ECO:0000250}. |
Sequence Caution | Sequence=AAD48939.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB81109.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
Similarity | Belongs to the MPDU1 (TC 2.A.43.3) family. {ECO:0000305}. |
Similarity | Contains 2 PQ-loop domains. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010602 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
18412994 | RefSeq | NP_567315 | 235 | mannose-P-dolichol utilization defect 1 protein |
Identical Sequences to LMP010602 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18412994 | EMBL | CBD02985.1 | 235 | unnamed protein product [Arabidopsis thaliana] |
GI:18412994 | EMBL | CBD07939.1 | 235 | unnamed protein product [Arabidopsis thaliana] |
GI:18412994 | EMBL | CBD34070.1 | 235 | unnamed protein product [Arabidopsis thaliana] |
GI:18412994 | EMBL | CBC95865.1 | 235 | unnamed protein product [Arabidopsis thaliana] |
GI:18412994 | EMBL | CBC97509.1 | 235 | unnamed protein product [Arabidopsis thaliana] |
GI:18412994 | GenBank | AEE82564.1 | 235 | mannose-P-dolichol utilization defect 1 protein [Arabidopsis thaliana] |
Related Sequences to LMP010602 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18412994 | GenBank | AAM64321.1 | 235 | unknown [Arabidopsis thaliana] |
GI:18412994 | GenBank | EFH48612.1 | 235 | PQ-loop repeat family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18412994 | RefSeq | XP_002872353.1 | 235 | PQ-loop repeat family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18412994 | RefSeq | XP_006288571.1 | 235 | hypothetical protein CARUB_v10001861mg [Capsella rubella] |
GI:18412994 | RefSeq | XP_010421729.1 | 235 | PREDICTED: mannose-P-dolichol utilization defect 1 protein homolog 2-like [Camelina sativa] |
GI:18412994 | RefSeq | XP_010455224.1 | 235 | PREDICTED: mannose-P-dolichol utilization defect 1 protein homolog 2 [Camelina sativa] |