Gene/Proteome Database (LMPD)

LMPD ID
LMP010619
Gene ID
826819
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
sterol-4alpha-methyl oxidase 1-1
Gene Symbol
SMO1-1
Synonyms
ATSMO1; ATSMO1-1; F16J13.180; F16J13_180; SMO1-1; STEROL 4-ALPHA-METHYL-OXIDASE 1; sterol-4alpha-methyl oxidase 1-1
Alternate Names
sterol-4alpha-methyl oxidase 1-1
Chromosome
4
EC Number
1.14.13.72
Summary
Encodes a member of the SMO1 family of sterol 4alpha-methyl oxidases. More specifically functions as a 4,4-dimethyl-9beta,19-cyclopropylsterol-4alpha- methyl oxidase.
Orthologs
View orthologs and multiple alignments for SMO1-1

Proteins

sterol-4alpha-methyl oxidase 1-1
Refseq ID NP_192948
Protein GI 15234416
UniProt ID Q8L7W5
mRNA ID NM_117281
Length 298
RefSeq Status REVIEWED
MIPYATVEEASIALGRNLTRLETLWFDYSATKSDYYLYCHNILFLFLVFSLVPLPLVFVELARSASGLFNRYKIQPKVNYSLSDMFKCYKDVMTMFILVVGPLQLVSYPSIQMIEIRSGLPLPTITEMLSQLVVYFLIEDYTNYWVHRFFHSKWGYDKIHRVHHEYTAPIGYAAPYAHWAEVLLLGIPTFMGPAIAPGHMITFWLWIALRQMEAIETHSGYDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFASVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNGGIKSD

Gene Information

Entrez Gene ID
826819
Gene Name
sterol-4alpha-methyl oxidase 1-1
Gene Symbol
SMO1-1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 TAS:TAIR C membrane
GO:0000254 IMP:TAIR F C-4 methylsterol oxidase activity
GO:0005506 IEA:InterPro F iron ion binding
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0016126 IMP:TAIR P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01100 Metabolic pathways
ath00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6254042 Bile acid and bile salt metabolism
6254041 Synthesis of bile acids and bile salts

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
sterol-4alpha-methyl oxidase 1-1
Protein Entry
SMO11_ARATH
UniProt ID
Q8L7W5
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-carbaldehyde + NAD(P)H + O(2) = 3-beta-hydroxy-4- beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)(+) + H(2)O. {ECO:0000269|PubMed:14653780}.
Catalytic Activity 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)(+) + H(2)O. {ECO:0000269|PubMed:14653780}.
Catalytic Activity 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 3-beta-hydroxy-4-beta- methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)(+) + 2 H(2)O. {ECO:0000269|PubMed:14653780}.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding.
Function Non-heme iron oxygenase involved in sterols biosynthesis. 4,4-dimethyl-9-beta,19-cyclopropylsterols such as 24-methylenecycloartanol are the preferred substrates. {ECO:0000269|PubMed:14653780}.
Miscellaneous Requires a membrane-bound cytochrome b5 as an obligatory electron carrier from NAD(P)H to SMO. {ECO:0000250}.
Sequence Caution Sequence=CAB40952.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAB78254.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010619 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15234416 RefSeq NP_192948 298 sterol-4alpha-methyl oxidase 1-1

Identical Sequences to LMP010619 proteins

Reference Database Accession Length Protein Name
GI:15234416 EMBL CAR81284.1 298 unnamed protein product [Arabidopsis thaliana]
GI:15234416 EMBL CBX84762.1 298 unnamed protein product [Arabidopsis thaliana]
GI:15234416 GenBank ACX17437.1 298 Sequence 44916 from patent US 7569389
GI:15234416 GenBank ACX19383.1 298 Sequence 47541 from patent US 7569389
GI:15234416 GenBank AEE83097.1 298 sterol-4alpha-methyl oxidase 1-1 [Arabidopsis thaliana]
GI:15234416 GenBank AEU45697.1 298 Sequence 7 from patent US 8053639

Related Sequences to LMP010619 proteins

Reference Database Accession Length Protein Name
GI:15234416 EMBL CAR81335.1 298 unnamed protein product [Arabidopsis thaliana]
GI:15234416 EMBL CAR81344.1 298 unnamed protein product [Arabidopsis thaliana]
GI:15234416 EMBL CBX84813.1 298 unnamed protein product [Arabidopsis thaliana]
GI:15234416 EMBL CBX84820.1 298 unnamed protein product [Arabidopsis thaliana]
GI:15234416 GenBank AAM64961.1 298 putative C-4 sterol methyl oxidase [Arabidopsis thaliana]
GI:15234416 GenBank AAQ13424.1 298 sterol-4-methyl-oxidase [Arabidopsis thaliana]