Gene/Proteome Database (LMPD)
LMPD ID
LMP010621
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
sterol 4-alpha methyl oxidase 1-3
Gene Symbol
Synonyms
ATSMO1; ATSMO1-3; SMO1; SMO1-3; sterol 4-alpha methyl oxidase 1-3; STEROL 4-ALPHA-METHYL-OXIDASE 1; STEROL C4-METHYL OXIDASE 1
Alternate Names
sterol 4-alpha methyl oxidase 1-3
Chromosome
4
EC Number
1.14.13.72
Summary
Encodes a member of the SMO1 family of sterol 4alpha-methyl oxidases.
Orthologs
Proteins
sterol 4-alpha methyl oxidase 1-3 | |
---|---|
Refseq ID | NP_001190801 |
Protein GI | 334186817 |
UniProt ID | F4JLZ6 |
mRNA ID | NM_001203872 |
Length | 581 |
RefSeq Status | REVIEWED |
MIPYPTVEDASVALGRNLTWFETVWFDYSATKSNFHVYCHTILVLFLVFSLAPFPLVIVEWTGWFDQFKIQKKVKYSLSDMFQCYKEVMKLFLLVVGTLQIVSYPSIQMVGIRSGLPLPSLMEIVAQLVVYFLIEDYTNYWIHRWMHCKWGYEKIHRIHHEYTSPIGYASPYAHWAEILILGIPTFLGPAIAPGHIMTFWLWISLRQFEAIETHSGYDFPWSVTKLIPFYGGPEYHDYHHYVGGQSQSNFASVFTYCDYIYGTDKGYRIHKKLLHHQIKEEAEEKRFCTALRALGSIMILIVIGIIGFTYYAVVVVNYGPALLIGGVDSLLSVLVLAFFHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQALIGEASVGDSSSHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYKSFLLFLFYTFLETTVVAVSLLPIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVLGFLIMHIMLVARNTTTIEAYEKHTVNWPYNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDFTSRSESETEPLQSL |
sterol 4-alpha methyl oxidase 1-3 | |
---|---|
Refseq ID | NP_567669 |
Protein GI | 18416002 |
UniProt ID | F4JLZ6 |
mRNA ID | NM_118403 |
Length | 291 |
RefSeq Status | REVIEWED |
MIPYPTVEDASVALGRNLTWFETVWFDYSATKSNFHVYCHTILVLFLVFSLAPFPLVIVEWTGWFDQFKIQKKVKYSLSDMFQCYKEVMKLFLLVVGTLQIVSYPSIQMVGIRSGLPLPSLMEIVAQLVVYFLIEDYTNYWIHRWMHCKWGYEKIHRIHHEYTSPIGYASPYAHWAEILILGIPTFLGPAIAPGHIMTFWLWISLRQFEAIETHSGYDFPWSVTKLIPFYGGPEYHDYHHYVGGQSQSNFASVFTYCDYIYGTDKGYRIHKKLLHHQIKEEAEEKRVRKHD |
Gene Information
Entrez Gene ID
Gene Name
sterol 4-alpha methyl oxidase 1-3
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0000254 | IEA:UniProtKB-EC | F | C-4 methylsterol oxidase activity |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
GO:0016126 | IEA:UniProtKB-KW | P | sterol biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
sterol 4-alpha methyl oxidase 1-3
Protein Entry
SMO13_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced. According to EST sequences.; Name=1; IsoId=F4JLZ6-1; Sequence=Displayed; |
Catalytic Activity | 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-carbaldehyde + NAD(P)H + O(2) = 3-beta-hydroxy-4- beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)(+) + H(2)O. |
Catalytic Activity | 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)(+) + H(2)O. |
Catalytic Activity | 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 3-beta-hydroxy-4-beta- methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)(+) + 2 H(2)O. |
Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
Function | Non-heme iron oxygenase involved in sterols biosynthesis. 4,4-dimethyl-9-beta,19-cyclopropylsterols such as 24-methylenecycloartanol are the preferred substrates. |
Miscellaneous | Requires a membrane-bound cytochrome b5 as an obligatory electron carrier from NAD(P)H to SMO. {ECO:0000250}. |
Sequence Caution | Sequence=AEE84650.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010621 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
334186817 | RefSeq | NP_001190801 | 581 | sterol 4-alpha methyl oxidase 1-3 |
18416002 | RefSeq | NP_567669 | 291 | sterol 4-alpha methyl oxidase 1-3 |
Identical Sequences to LMP010621 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18416002 | EMBL | CAR81288.1 | 291 | unnamed protein product [Arabidopsis thaliana] |
GI:18416002 | EMBL | CBX84766.1 | 291 | unnamed protein product [Arabidopsis thaliana] |
GI:18416002 | GenBank | ACX17777.1 | 291 | Sequence 45375 from patent US 7569389 |
GI:18416002 | GenBank | AEE84649.1 | 291 | sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana] |
GI:334186817 | GenBank | AEE84650.1 | 581 | sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana] |
GI:18416002 | GenBank | AEU45699.1 | 291 | Sequence 9 from patent US 8053639 |
GI:18416002 | SwissProt | F4JLZ6.1 | 291 | RecName: Full=Methylsterol monooxygenase 1-3; AltName: Full=Sterol 4-alpha-methyl-oxidase 1-3; Short=AtSMO1-3 [Arabidopsis thaliana] |
Related Sequences to LMP010621 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:334186817 | EMBL | CAB79230.1 | 820 | predicted protein [Arabidopsis thaliana] |
GI:18416002 | EMBL | CAR81332.1 | 273 | unnamed protein product [Arabidopsis thaliana] |
GI:18416002 | EMBL | CBX84810.1 | 273 | unnamed protein product [Arabidopsis thaliana] |
GI:334186817 | EMBL | CDX82967.1 | 583 | BnaC01g14170D [Brassica napus] |
GI:18416002 | GenBank | AAQ94118.1 | 273 | sterol-4-alpha methyl oxidase, partial [Arabidopsis thaliana] |
GI:18416002 | GenBank | AEE84650.1 | 581 | sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana] |
GI:334186817 | GenBank | EOA16312.1 | 574 | hypothetical protein CARUB_v10004463mg [Capsella rubella] |
GI:334186817 | GenBank | ESQ55079.1 | 599 | hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum] |
GI:18416002 | GenBank | ESQ55079.1 | 599 | hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum] |
GI:18416002 | RefSeq | NP_001190801.1 | 581 | sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana] |
GI:334186817 | RefSeq | XP_006283414.1 | 574 | hypothetical protein CARUB_v10004463mg [Capsella rubella] |
GI:334186817 | RefSeq | XP_006413626.1 | 599 | hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum] |