Gene/Proteome Database (LMPD)

LMPD ID
LMP010621
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
sterol 4-alpha methyl oxidase 1-3
Gene Symbol
Synonyms
ATSMO1; ATSMO1-3; SMO1; SMO1-3; sterol 4-alpha methyl oxidase 1-3; STEROL 4-ALPHA-METHYL-OXIDASE 1; STEROL C4-METHYL OXIDASE 1
Alternate Names
sterol 4-alpha methyl oxidase 1-3
Chromosome
4
EC Number
1.14.13.72
Summary
Encodes a member of the SMO1 family of sterol 4alpha-methyl oxidases.
Orthologs

Proteins

sterol 4-alpha methyl oxidase 1-3
Refseq ID NP_001190801
Protein GI 334186817
UniProt ID F4JLZ6
mRNA ID NM_001203872
Length 581
RefSeq Status REVIEWED
MIPYPTVEDASVALGRNLTWFETVWFDYSATKSNFHVYCHTILVLFLVFSLAPFPLVIVEWTGWFDQFKIQKKVKYSLSDMFQCYKEVMKLFLLVVGTLQIVSYPSIQMVGIRSGLPLPSLMEIVAQLVVYFLIEDYTNYWIHRWMHCKWGYEKIHRIHHEYTSPIGYASPYAHWAEILILGIPTFLGPAIAPGHIMTFWLWISLRQFEAIETHSGYDFPWSVTKLIPFYGGPEYHDYHHYVGGQSQSNFASVFTYCDYIYGTDKGYRIHKKLLHHQIKEEAEEKRFCTALRALGSIMILIVIGIIGFTYYAVVVVNYGPALLIGGVDSLLSVLVLAFFHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQALIGEASVGDSSSHGVRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYKSFLLFLFYTFLETTVVAVSLLPIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVLGFLIMHIMLVARNTTTIEAYEKHTVNWPYNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDFTSRSESETEPLQSL
sterol 4-alpha methyl oxidase 1-3
Refseq ID NP_567669
Protein GI 18416002
UniProt ID F4JLZ6
mRNA ID NM_118403
Length 291
RefSeq Status REVIEWED
MIPYPTVEDASVALGRNLTWFETVWFDYSATKSNFHVYCHTILVLFLVFSLAPFPLVIVEWTGWFDQFKIQKKVKYSLSDMFQCYKEVMKLFLLVVGTLQIVSYPSIQMVGIRSGLPLPSLMEIVAQLVVYFLIEDYTNYWIHRWMHCKWGYEKIHRIHHEYTSPIGYASPYAHWAEILILGIPTFLGPAIAPGHIMTFWLWISLRQFEAIETHSGYDFPWSVTKLIPFYGGPEYHDYHHYVGGQSQSNFASVFTYCDYIYGTDKGYRIHKKLLHHQIKEEAEEKRVRKHD

Gene Information

Entrez Gene ID
Gene Name
sterol 4-alpha methyl oxidase 1-3
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0000254 IEA:UniProtKB-EC F C-4 methylsterol oxidase activity
GO:0005506 IEA:InterPro F iron ion binding
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0016126 IEA:UniProtKB-KW P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01100 Metabolic pathways
ath00100 Steroid biosynthesis
ko00100 Steroid biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
sterol 4-alpha methyl oxidase 1-3
Protein Entry
SMO13_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=1; Comment=A number of isoforms are produced. According to EST sequences.; Name=1; IsoId=F4JLZ6-1; Sequence=Displayed;
Catalytic Activity 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-carbaldehyde + NAD(P)H + O(2) = 3-beta-hydroxy-4- beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)(+) + H(2)O.
Catalytic Activity 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)(+) + H(2)O.
Catalytic Activity 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 3-beta-hydroxy-4-beta- methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)(+) + 2 H(2)O.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding.
Function Non-heme iron oxygenase involved in sterols biosynthesis. 4,4-dimethyl-9-beta,19-cyclopropylsterols such as 24-methylenecycloartanol are the preferred substrates.
Miscellaneous Requires a membrane-bound cytochrome b5 as an obligatory electron carrier from NAD(P)H to SMO. {ECO:0000250}.
Sequence Caution Sequence=AEE84650.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010621 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
334186817 RefSeq NP_001190801 581 sterol 4-alpha methyl oxidase 1-3
18416002 RefSeq NP_567669 291 sterol 4-alpha methyl oxidase 1-3

Identical Sequences to LMP010621 proteins

Reference Database Accession Length Protein Name
GI:18416002 EMBL CAR81288.1 291 unnamed protein product [Arabidopsis thaliana]
GI:18416002 EMBL CBX84766.1 291 unnamed protein product [Arabidopsis thaliana]
GI:18416002 GenBank ACX17777.1 291 Sequence 45375 from patent US 7569389
GI:18416002 GenBank AEE84649.1 291 sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
GI:334186817 GenBank AEE84650.1 581 sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
GI:18416002 GenBank AEU45699.1 291 Sequence 9 from patent US 8053639
GI:18416002 SwissProt F4JLZ6.1 291 RecName: Full=Methylsterol monooxygenase 1-3; AltName: Full=Sterol 4-alpha-methyl-oxidase 1-3; Short=AtSMO1-3 [Arabidopsis thaliana]

Related Sequences to LMP010621 proteins

Reference Database Accession Length Protein Name
GI:334186817 EMBL CAB79230.1 820 predicted protein [Arabidopsis thaliana]
GI:18416002 EMBL CAR81332.1 273 unnamed protein product [Arabidopsis thaliana]
GI:18416002 EMBL CBX84810.1 273 unnamed protein product [Arabidopsis thaliana]
GI:334186817 EMBL CDX82967.1 583 BnaC01g14170D [Brassica napus]
GI:18416002 GenBank AAQ94118.1 273 sterol-4-alpha methyl oxidase, partial [Arabidopsis thaliana]
GI:18416002 GenBank AEE84650.1 581 sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
GI:334186817 GenBank EOA16312.1 574 hypothetical protein CARUB_v10004463mg [Capsella rubella]
GI:334186817 GenBank ESQ55079.1 599 hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
GI:18416002 GenBank ESQ55079.1 599 hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
GI:18416002 RefSeq NP_001190801.1 581 sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
GI:334186817 RefSeq XP_006283414.1 574 hypothetical protein CARUB_v10004463mg [Capsella rubella]
GI:334186817 RefSeq XP_006413626.1 599 hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]