Gene/Proteome Database (LMPD)
LMPD ID
LMP010659
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
glycosylphosphatidylinositol-anchored lipid protein transfer 1
Gene Symbol
Synonyms
F13K9.6; F13K9_6; glycosylphosphatidylinositol-anchored lipid protein transfer 1; LTPG1
Alternate Names
glycosylphosphatidylinositol-anchored lipid protein transfer 1
Chromosome
1
Summary
Encodes LTPG1, a lipid transfer protein with a predicted GPI (glycosylphosphatidylinositol)-anchor domain. Localized in the plasma membrane. Disruption of the LTPG1 gene causes alterations of cuticular lipid composition, but no significant changes on total wax and cutin monomer loads are seen.
Orthologs
Proteins
| glycosylphosphatidylinositol-anchored lipid protein transfer 1 | |
|---|---|
| Refseq ID | NP_174116 |
| Protein GI | 15217777 |
| UniProt ID | Q9C7F7 |
| mRNA ID | NM_102560 |
| Length | 193 |
| RefSeq Status | REVIEWED |
| MKGLHLHLVLVTMTIVASIAAAAPAAPGGALADECNQDFQKVTLCLDFATGKATIPSKKCCDAVEDIKERDPKCLCFVIQQAKTGGQALKDLGVQEDKLIQLPTSCQLHNASITNCPKLLGISPSSPDAAVFTNNATTTPVAPAGKSPATPATSTDKGGSASAKDGHAVVALAVALMAVSFVLTLPRHVTLGM | |
Gene Information
Entrez Gene ID
Gene Name
glycosylphosphatidylinositol-anchored lipid protein transfer 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0031225 | TAS:TAIR | C | anchored component of membrane |
| GO:0046658 | IDA:UniProtKB | C | anchored component of plasma membrane |
| GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0009505 | IDA:UniProtKB | C | plant-type cell wall |
| GO:0005886 | IDA:UniProtKB | C | plasma membrane |
| GO:0008289 | IDA:UniProtKB | F | lipid binding |
| GO:0042335 | IMP:UniProtKB | P | cuticle development |
| GO:0050832 | IMP:UniProtKB | P | defense response to fungus |
| GO:0006869 | IMP:UniProtKB | P | lipid transport |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016140 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain |
UniProt Annotations
Entry Information
Gene Name
glycosylphosphatidylinositol-anchored lipid protein transfer 1
Protein Entry
LTPG1_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | High levels in the aerial portion of 10 days old seedlings. Accumulates in the epidermis during cuticle biosynthesis (e.g. in inflorescence stems). Also detected in flowers, in upper portion of the styles, pollen, veins of the sepals and petals, silique walls and seeds in the early stages of development. In epidermis, present in trichomes, leaf mesophyll cells, and stem cortex and xylem. {ECO:0000269|PubMed:19321705, ECO:0000269|PubMed:19366900}. |
| Disruption Phenotype | Reduced cuticular wax load on the stem surface and in silique walls, with altered cuticular lipid composition (especially C29 alkane) associated with diffuse cuticular layer structure. Increased number of plastoglobules in the stem cortex and leaf mesophyll cells, protrusions of the cytoplasm into the vacuole in the epidermis, and enhanced susceptibility to infection by the necrotrophic fungal pathogen Alternaria brassicicola. {ECO:0000269|PubMed:19321705, ECO:0000269|PubMed:19366900, ECO:0000269|PubMed:22891199}. |
| Function | Lipid transfer protein that, together with LTPG2, binds to lipids and functions as a component of the cuticular lipid export machinery that performs extensive export of intracellular lipids (e.g. C29 alkane) from epidermal cells to the surface to build the cuticular wax layer and silique walls. Involved in the establishment of resistance to the necrotrophic fungal pathogen Alternaria brassicicola. {ECO:0000269|PubMed:19321705, ECO:0000269|PubMed:19366900, ECO:0000269|PubMed:22891199}. |
| Ptm | O-glycosylated on hydroxyprolines; noncontiguous hydroxylproline residues are glycosylated with arabinogalactan. {ECO:0000250}. |
| Similarity | Belongs to the plant LTP family. {ECO:0000305}. |
| Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Secreted, cell wall. Endoplasmic reticulum. Golgi apparatus. Note=Targeted to the plasma membrane via the vesicular trafficking system. Localized to the plasma membrane on all faces of epidermal cells. Also detected in the periclinal cell wall. In young meristematic cells, observed in plasma membrane and in puncta resembling the Golgi. |
| Tissue Specificity | Up-regulated in the epidermis of stems and leaves. Expressed in the epidermis, stem cortex, vascular bundles and mesophyll cells in root tips, seedlings, leaves, caulines, flowers, siliques, pollen, and early-developing seeds. {ECO:0000269|PubMed:16299169, ECO:0000269|PubMed:19321705}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010659 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15217777 | RefSeq | NP_174116 | 193 | glycosylphosphatidylinositol-anchored lipid protein transfer 1 |
Identical Sequences to LMP010659 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15217777 | GenBank | AAG51485.1 | 193 | lipid transfer protein, putative [Arabidopsis thaliana] |
| GI:15217777 | GenBank | AAM12955.1 | 193 | lipid transfer protein, putative [Arabidopsis thaliana] |
| GI:15217777 | GenBank | AAM91112.1 | 193 | lipid transfer protein, putative [Arabidopsis thaliana] |
| GI:15217777 | GenBank | AEE30894.1 | 193 | glycosylphosphatidylinositol-anchored lipid protein transfer 1 [Arabidopsis thaliana] |
| GI:15217777 | SwissProt | Q9C7F7.1 | 193 | RecName: Full=Non-specific lipid transfer protein GPI-anchored 1; Short=AtLTPG-1; Short=Protein LTP-GPI-ANCHORED 1; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010659 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15217777 | GenBank | AAM62634.1 | 193 | lipid transfer protein, putative [Arabidopsis thaliana] |
| GI:15217777 | GenBank | EFH67011.1 | 197 | hypothetical protein ARALYDRAFT_890328 [Arabidopsis lyrata subsp. lyrata] |
| GI:15217777 | GenBank | EOA38536.1 | 197 | hypothetical protein CARUB_v10010343mg [Capsella rubella] |
| GI:15217777 | RefSeq | XP_002890752.1 | 197 | hypothetical protein ARALYDRAFT_890328 [Arabidopsis lyrata subsp. lyrata] |
| GI:15217777 | RefSeq | XP_006305638.1 | 197 | hypothetical protein CARUB_v10010343mg [Capsella rubella] |
| GI:15217777 | RefSeq | XP_010499289.1 | 198 | PREDICTED: non-specific lipid transfer protein GPI-anchored 1 [Camelina sativa] |