Gene/Proteome Database (LMPD)
Proteins
| non-specific lipid transfer protein GPI-anchored 2 | |
|---|---|
| Refseq ID | NP_001030803 |
| Protein GI | 79314090 |
| UniProt ID | Q9LZH5 |
| mRNA ID | NM_001035726 |
| Length | 191 |
| RefSeq Status | REVIEWED |
| MSNVVVIAVVLIVASLTGHVSAQMDMSPSSGPSGAPDCMANLMNMTGCLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLLSGDMAAQLGIKIDKAKALKLPGVCGVITPDPSLCSLFGIPVGAPVAMGDEGASPAYAPGSMSESPGGFGSGPSASRGSDAPSSAPYSLFLNLIIFPLAFAFYIFC | |
| non-specific lipid transfer protein GPI-anchored 2 | |
|---|---|
| Refseq ID | NP_189958 |
| Protein GI | 15229756 |
| UniProt ID | Q9LZH5 |
| mRNA ID | NM_114240 |
| Length | 193 |
| RefSeq Status | REVIEWED |
| MSNVVVIAVVLIVASLTGHVSAQMDMSPSSGPSGAPDCMANLMNMTGCLSYVTVGEGGGAAKPDKTCCPALAGLVESSPQCLCYLLSGDMAAQLGIKIDKAKALKLPGVCGVITPDPSLCSLFGIPVGAPVAMGDEGASPAYAPGSMSGAESPGGFGSGPSASRGSDAPSSAPYSLFLNLIIFPLAFAFYIFC | |
Gene Information
Entrez Gene ID
Gene Name
non-specific lipid transfer protein GPI-anchored 2
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031225 | TAS:TAIR | C | anchored component of membrane |
| GO:0046658 | IDA:UniProtKB | C | anchored component of plasma membrane |
| GO:0005886 | ISS:UniProtKB | C | plasma membrane |
| GO:0008289 | ISS:UniProtKB | F | lipid binding |
| GO:0042335 | IMP:UniProtKB | P | cuticle development |
| GO:0006869 | ISS:UniProtKB | P | lipid transport |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016140 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain |
UniProt Annotations
Entry Information
Gene Name
non-specific lipid transfer protein GPI-anchored 2
Protein Entry
LTPG2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9LZH5-1; Sequence=Displayed; Name=2; IsoId=Q9LZH5-2; Sequence=VSP_053833; Note=Derived from EST data. No experimental confirmation available.; Name=3; IsoId=Q9LZH5-3; Sequence=VSP_053832; Note=No experimental confirmation available.; |
| Developmental Stage | Strongly expressed in the aerial portions and root tips of seedlings. Present in stem and leaf epidermis, including the trichomes, leaf mesophyll cells, and stem cortex and xylem. In flowers, observed in the upper portion of the styles, anther filament, and veins of the sepals and petals, silique walls and developing seeds. {ECO:0000269|PubMed:22891199}. |
| Disruption Phenotype | Reduced cuticular wax load on the stem surface and in silique walls, with altered cuticular lipid composition (especially C29 alkane) associated with diffuse cuticular layer structure. {ECO:0000269|PubMed:22891199}. |
| Function | Lipid transfer protein that, together with LTPG1, binds to lipids and functions as a component of the cuticular lipid export machinery that performs extensive export of intracellular lipids (e.g. C29 alkane) from epidermal cells to the surface to build the cuticular wax layer and silique walls. {ECO:0000269|PubMed:22891199}. |
| Ptm | O-glycosylated on hydroxyprolines; noncontiguous hydroxylproline residues are glycosylated with arabinogalactan. {ECO:0000250}. |
| Similarity | Belongs to the plant LTP family. {ECO:0000305}. |
| Subcellular Location | Cell membrane {ECO:0000269|PubMed:22891199}; Lipid-anchor, GPI-anchor {ECO:0000269|PubMed:22891199}. Note=Targeted to the plasma membrane via the vesicular trafficking system. |
| Tissue Specificity | Up-regulated in the epidermis of top stems. Expressed in roots, seedlings, leaves, stems, buds, flower and silique walls. {ECO:0000269|PubMed:16299169, ECO:0000269|PubMed:22891199}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010660 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15229756 | RefSeq | NP_189958 | 193 | non-specific lipid transfer protein GPI-anchored 2 |
| 79314090 | RefSeq | NP_001030803 | 191 | non-specific lipid transfer protein GPI-anchored 2 |
Identical Sequences to LMP010660 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15229756 | DBBJ | BAE73261.1 | 193 | xylogen like protein 5 [Arabidopsis thaliana] |
| GI:15229756 | EMBL | CAB83144.1 | 193 | lipid-transfer-like protein [Arabidopsis thaliana] |
| GI:15229756 | GenBank | AAK76582.1 | 193 | putative lipid transfer protein [Arabidopsis thaliana] |
| GI:15229756 | GenBank | AAL85151.1 | 193 | putative lipid-transfer protein [Arabidopsis thaliana] |
| GI:15229756 | GenBank | AEE77821.1 | 193 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:79314090 | GenBank | AEE77822.1 | 191 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:15229756 | SwissProt | Q9LZH5.1 | 193 | RecName: Full=Non-specific lipid transfer protein GPI-anchored 2; Short=AtLTPG-2; Short=Protein LTP-GPI-ANCHORED 2; AltName: Full=Xylogen-like protein 5; Short=AtXYP5; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010660 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:79314090 | DBBJ | BAE73261.1 | 193 | xylogen like protein 5 [Arabidopsis thaliana] |
| GI:15229756 | DBBJ | BAH56934.1 | 187 | AT3G43720 [Arabidopsis thaliana] |
| GI:79314090 | EMBL | CAB83144.1 | 193 | lipid-transfer-like protein [Arabidopsis thaliana] |
| GI:79314090 | GenBank | AAK76582.1 | 193 | putative lipid transfer protein [Arabidopsis thaliana] |
| GI:79314090 | GenBank | AAL85151.1 | 193 | putative lipid-transfer protein [Arabidopsis thaliana] |
| GI:15229756 | GenBank | AAM66942.1 | 193 | lipid-transfer protein-like protein [Arabidopsis thaliana] |
| GI:15229756 | GenBank | EFH53553.1 | 196 | lipid binding protein [Arabidopsis lyrata subsp. lyrata] |
| GI:79314090 | GenBank | AEE77821.1 | 193 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:15229756 | GenBank | AEE77822.1 | 191 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:79314090 | RefSeq | NP_189958.1 | 193 | non-specific lipid transfer protein GPI-anchored 2 [Arabidopsis thaliana] |
| GI:15229756 | RefSeq | NP_001030803.1 | 191 | non-specific lipid transfer protein GPI-anchored 2 [Arabidopsis thaliana] |
| GI:15229756 | RefSeq | XP_002877294.1 | 196 | lipid binding protein [Arabidopsis lyrata subsp. lyrata] |