Gene/Proteome Database (LMPD)

LMPD ID
LMP010661
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Gene Symbol
Synonyms
T8P21.22; T8P21_22
Chromosome
2

Proteins

protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Refseq ID NP_565872
Protein GI 18404577
UniProt ID Q9SHA0
mRNA ID NM_129343
Length 115
RefSeq Status REVIEWED
MKCCKFVAVALMSLLISLASVEAAGECGRMPINQAAASLSPCLPATKNPRGKVPPVCCAKVGALIRTNPRCLCAVMLSPLAKKAGINPGIAIGVPKRCNIRNRPAGKRCGRYIVP

Gene Information

Entrez Gene ID
Gene Name
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009506 IDA:TAIR C plasmodesma
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0008233 IEA:UniProtKB-KW F peptidase activity
GO:0006869 IEA:InterPro P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Protein Entry
Q9SHA0_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
Similarity Belongs to the plant LTP family.

Identical and Related Proteins

Unique RefSeq proteins for LMP010661 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18404577 RefSeq NP_565872 115 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein

Identical Sequences to LMP010661 proteins

Reference Database Accession Length Protein Name
GI:18404577 GenBank AAK96826.1 115 Unknown protein [Arabidopsis thaliana]
GI:18404577 GenBank AAL66904.1 115 unknown protein [Arabidopsis thaliana]
GI:18404577 GenBank AEC09460.1 115 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein [Arabidopsis thaliana]

Related Sequences to LMP010661 proteins

Reference Database Accession Length Protein Name
GI:18404577 EMBL CDX93346.1 115 BnaC04g45500D [Brassica napus]
GI:18404577 GenBank EFH55971.1 115 protease inhibitor/seed storage/lipid transfer protein family protein [Arabidopsis lyrata subsp. lyrata]
GI:18404577 GenBank ESQ52438.1 115 hypothetical protein EUTSA_v10017444mg [Eutrema salsugineum]
GI:18404577 GenBank KFK36683.1 115 hypothetical protein AALP_AA4G156000 [Arabis alpina]
GI:18404577 RefSeq XP_002879712.1 115 protease inhibitor/seed storage/lipid transfer protein family protein [Arabidopsis lyrata subsp. lyrata]
GI:18404577 RefSeq XP_006410985.1 115 hypothetical protein EUTSA_v10017444mg [Eutrema salsugineum]