Gene/Proteome Database (LMPD)
Proteins
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein | |
---|---|
Refseq ID | NP_565872 |
Protein GI | 18404577 |
UniProt ID | Q9SHA0 |
mRNA ID | NM_129343 |
Length | 115 |
RefSeq Status | REVIEWED |
MKCCKFVAVALMSLLISLASVEAAGECGRMPINQAAASLSPCLPATKNPRGKVPPVCCAKVGALIRTNPRCLCAVMLSPLAKKAGINPGIAIGVPKRCNIRNRPAGKRCGRYIVP |
Gene Information
Entrez Gene ID
Gene Name
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009506 | IDA:TAIR | C | plasmodesma |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0008233 | IEA:UniProtKB-KW | F | peptidase activity |
GO:0006869 | IEA:InterPro | P | lipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Protein Entry
Q9SHA0_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Function | Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. |
Similarity | Belongs to the plant LTP family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010661 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
18404577 | RefSeq | NP_565872 | 115 | protease inhibitor/seed storage/lipid transfer protein (LTP) family protein |
Identical Sequences to LMP010661 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18404577 | GenBank | AAK96826.1 | 115 | Unknown protein [Arabidopsis thaliana] |
GI:18404577 | GenBank | AAL66904.1 | 115 | unknown protein [Arabidopsis thaliana] |
GI:18404577 | GenBank | AEC09460.1 | 115 | protease inhibitor/seed storage/lipid transfer protein (LTP) family protein [Arabidopsis thaliana] |
Related Sequences to LMP010661 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18404577 | EMBL | CDX93346.1 | 115 | BnaC04g45500D [Brassica napus] |
GI:18404577 | GenBank | EFH55971.1 | 115 | protease inhibitor/seed storage/lipid transfer protein family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18404577 | GenBank | ESQ52438.1 | 115 | hypothetical protein EUTSA_v10017444mg [Eutrema salsugineum] |
GI:18404577 | GenBank | KFK36683.1 | 115 | hypothetical protein AALP_AA4G156000 [Arabis alpina] |
GI:18404577 | RefSeq | XP_002879712.1 | 115 | protease inhibitor/seed storage/lipid transfer protein family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18404577 | RefSeq | XP_006410985.1 | 115 | hypothetical protein EUTSA_v10017444mg [Eutrema salsugineum] |