Gene/Proteome Database (LMPD)

LMPD ID
LMP010662
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
lipid-transfer protein 6
Gene Symbol
Synonyms
lipid transfer protein 6; LIPID TRANSFER PROTEIN 6; LTP6
Chromosome
3
Summary
Predicted to encode a PR (pathogenesis-related) protein. Belongs to the lipid transfer protein (PR-14) family with the following members: At2g38540/LTP1, At2g38530/LTP2, At5g59320/LTP3, At5g59310/LTP4, At3g51600/LTP5, At3g08770/LTP6, At2g15050/LTP7, At2g18370/LTP8, At2g15325/LTP9, At5g01870/LTP10, At4g33355/LTP11, At3g51590/LTP12, At5g44265/LTP13, At5g62065/LTP14, At4g08530/LTP15.
Orthologs

Proteins

lipid-transfer protein 6
Refseq ID NP_001189842
Protein GI 334185176
UniProt ID F4IXC6
mRNA ID NM_001202913
Length 117
RefSeq Status REVIEWED
MRSLLLAVCLVLALHCGEAAVSCNTVIADLYPCLSYVTQGGPVPTLCCNGLTTLKSQAQTSVDRQGVCRCIKSAIGGLTLSPRTIQNALELPSKCGVDLPYKFSPSTDCDSETSRKS
lipid-transfer protein 6
Refseq ID NP_187489
Protein GI 15231964
UniProt ID Q9LDB4
mRNA ID NM_111711
Length 113
RefSeq Status REVIEWED
MRSLLLAVCLVLALHCGEAAVSCNTVIADLYPCLSYVTQGGPVPTLCCNGLTTLKSQAQTSVDRQGVCRCIKSAIGGLTLSPRTIQNALELPSKCGVDLPYKFSPSTDCDSIQ

Gene Information

Entrez Gene ID
Gene Name
lipid-transfer protein 6
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 IEA:InterPro P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
lipid-transfer protein 6
Protein Entry
NLTP6_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
Similarity Belongs to the plant LTP family.

Identical and Related Proteins

Unique RefSeq proteins for LMP010662 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
334185176 RefSeq NP_001189842 117 lipid-transfer protein 6
15231964 RefSeq NP_187489 113 lipid-transfer protein 6

Identical Sequences to LMP010662 proteins

Reference Database Accession Length Protein Name
GI:15231964 DBBJ BAE73271.1 113 xylogen like protein 15 [Arabidopsis thaliana]
GI:15231964 GenBank AAL24433.1 113 putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
GI:15231964 GenBank AAM10179.1 113 putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
GI:15231964 GenBank AAM63704.1 113 putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
GI:15231964 GenBank AEE74676.1 113 lipid-transfer protein 6 [Arabidopsis thaliana]
GI:334185176 GenBank AEE74677.1 117 lipid-transfer protein 6 [Arabidopsis thaliana]
GI:15231964 SwissProt Q9LDB4.1 113 RecName: Full=Non-specific lipid-transfer protein 6; Short=LTP 6; AltName: Full=Xylogen-like protein 15; Short=AtXYP15; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010662 proteins

Reference Database Accession Length Protein Name
GI:334185176 GenBank AAF76932.1 113 lipid transfer protein 6 [Arabidopsis thaliana]
GI:334185176 GenBank AAG51363.1 113 putative nonspecific lipid-transfer protein; 75707-75272 [Arabidopsis thaliana]
GI:334185176 GenBank AAL24433.1 113 putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
GI:15231964 GenBank EFH60954.1 113 hypothetical protein ARALYDRAFT_478179 [Arabidopsis lyrata subsp. lyrata]
GI:334185176 GenBank AEE74676.1 113 lipid-transfer protein 6 [Arabidopsis thaliana]
GI:15231964 GenBank AEE74677.1 117 lipid-transfer protein 6 [Arabidopsis thaliana]
GI:15231964 GenBank ESQ49196.1 113 hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
GI:334185176 RefSeq NP_187489.1 113 lipid-transfer protein 6 [Arabidopsis thaliana]
GI:15231964 RefSeq XP_002884695.1 113 hypothetical protein ARALYDRAFT_478179 [Arabidopsis lyrata subsp. lyrata]
GI:15231964 RefSeq NP_001189842.1 117 lipid-transfer protein 6 [Arabidopsis thaliana]
GI:15231964 RefSeq XP_006407743.1 113 hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
GI:334185176 SwissProt Q9LDB4.1 113 RecName: Full=Non-specific lipid-transfer protein 6; Short=LTP 6; AltName: Full=Xylogen-like protein 15; Short=AtXYP15; Flags: Precursor [Arabidopsis thaliana]