Gene/Proteome Database (LMPD)

LMPD ID
LMP010664
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
pathogenesis-related lipid transfer protein
Gene Symbol
Synonyms
T20L15.140; T20L15_140
Alternate Names
pathogenesis-related lipid transfer protein
Chromosome
5

Proteins

pathogenesis-related lipid transfer protein
Refseq ID NP_195807
Protein GI 15241086
UniProt ID Q9LZV9
mRNA ID NM_120265
Length 116
RefSeq Status REVIEWED
MMRVVLPLCLLLASIFAWGSEAAISCNAVQANLYPCVVYVVQGGAIPYSCCNGIRMLSKQATSASDKQGVCRCIKSVVGRVSYSSIYLKKAAALPGKCGVKLPYKIDPSTNCNSIK

Gene Information

Entrez Gene ID
Gene Name
pathogenesis-related lipid transfer protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005886 IDA:TAIR C plasma membrane
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 IEA:InterPro P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
pathogenesis-related lipid transfer protein
Protein Entry
NLTPA_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}.
Similarity Belongs to the plant LTP family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010664 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15241086 RefSeq NP_195807 116 pathogenesis-related lipid transfer protein

Identical Sequences to LMP010664 proteins

Reference Database Accession Length Protein Name
GI:15241086 DBBJ BAE99954.1 116 lipid-transfer protein-like [Arabidopsis thaliana]
GI:15241086 EMBL CAB82757.1 116 lipid-transfer protein-like [Arabidopsis thaliana]
GI:15241086 GenBank AAO44017.1 116 At5g01870 [Arabidopsis thaliana]
GI:15241086 GenBank ADT59573.1 116 Sequence 36 from patent US 7847156
GI:15241086 gnl TAIR 116 pathogenesis-related lipid transfer protein [Arabidopsis thaliana]
GI:15241086 SwissProt Q9LZV9.1 116 RecName: Full=Non-specific lipid-transfer protein 10; Short=LTP 10; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010664 proteins

Reference Database Accession Length Protein Name
GI:15241086 GenBank EFH49247.1 116 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:15241086 GenBank KFK24679.1 120 hypothetical protein AALP_AA8G011100 [Arabis alpina]
GI:15241086 RefSeq XP_002872988.1 116 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:15241086 RefSeq XP_006407743.1 113 hypothetical protein EUTSA_v10021759mg [Eutrema salsugineum]
GI:15241086 RefSeq XP_010424833.1 98 PREDICTED: non-specific lipid-transfer protein 10-like [Camelina sativa]
GI:15241086 RefSeq XP_010451927.1 116 PREDICTED: non-specific lipid-transfer protein 10 [Camelina sativa]