Gene/Proteome Database (LMPD)
Proteins
| protease inhibitor/seed storage/LTP family protein | |
|---|---|
| Refseq ID | NP_001078707 |
| Protein GI | 145334723 |
| UniProt ID | A8MQA2 |
| mRNA ID | NM_001085238 |
| Length | 126 |
| RefSeq Status | REVIEWED |
| MDTHTTKLVAISLLLLLVISDYTRLMIQVHSYVPFCAYTYDYFSYCLDFLTGYYYKPGKKCCVHIVKLNIIAKHKKENPRLLCNCVEMMTRGYTPPMLADKIQQLPLLCNTHLSFPISSSMDCSTV | |
Gene Information
Entrez Gene ID
Gene Name
protease inhibitor/seed storage/LTP family protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0006810 | IEA:UniProtKB-KW | P | transport |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016140 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain |
UniProt Annotations
Entry Information
Gene Name
protease inhibitor/seed storage/LTP family protein
Protein Entry
NLTPD_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Function | Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the plant LTP family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010667 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 145334723 | RefSeq | NP_001078707 | 126 | protease inhibitor/seed storage/LTP family protein |
Identical Sequences to LMP010667 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145334723 | gnl | TAIR | 126 | protease inhibitor/seed storage/LTP family protein [Arabidopsis thaliana] |
| GI:145334723 | SwissProt | A8MQA2.1 | 126 | RecName: Full=Non-specific lipid-transfer protein 13; Short=LTP 13; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010667 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145334723 | GenBank | EFH39859.1 | 126 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:145334723 | GenBank | EOA14779.1 | 125 | hypothetical protein CARUB_v10028079mg [Capsella rubella] |
| GI:145334723 | RefSeq | XP_002863600.1 | 126 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:145334723 | RefSeq | XP_006281881.1 | 125 | hypothetical protein CARUB_v10028079mg [Capsella rubella] |
| GI:145334723 | RefSeq | XP_010441909.1 | 125 | PREDICTED: non-specific lipid-transfer protein 13-like [Camelina sativa] |
| GI:145334723 | RefSeq | XP_010494431.1 | 125 | PREDICTED: non-specific lipid-transfer protein 13 [Camelina sativa] |