Gene/Proteome Database (LMPD)

LMPD ID
LMP010669
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
non-specific lipid-transfer protein 2
Gene Symbol
Synonyms
cdf3; cell growth defect factor-3; LIPID TRANSFER PROTEIN; lipid transfer protein 2; LP2; LTP2; T6A23.27; T6A23_27
Alternate Names
non-specific lipid-transfer protein 2
Chromosome
2
Summary
Involved in lipid transfer between membranes. Belongs to a family of Lipid transfer proteins. Sequence similarity to other plant/Arabidopsis LPT genes but highest similarity to LPT1. Stress and pathogen-inducible motifs found in the upstream region. Expressed in flower, leaves and siliques but absent in roots. Predicted to be a member of PR-14 pathogenesis-related protein family with the following members: At2g38540/LTP1, At2g38530/LTP2, At5g59320/LTP3, At5g59310/LTP4, At3g51600/LTP5, At3g08770/LTP6, At2g15050/LTP7, At2g18370/LTP8, At2g15325/LTP9, At5g01870/LTP10, At4g33355/LTP11, At3g51590/LTP12, At5g44265/LTP13, At5g62065/LTP14, At4g08530/LTP15.
Orthologs

Proteins

non-specific lipid-transfer protein 2
Refseq ID NP_181387
Protein GI 15224898
UniProt ID Q9S7I3
mRNA ID NM_129410
Length 118
RefSeq Status REVIEWED
MAGVMKLACMVLACMIVAGPITANALMSCGTVNGNLAGCIAYLTRGAPLTQGCCNGVTNLKNMASTTPDRQQACRCLQSAAKAVGPGLNTARAAGLPSACKVNIPYKISASTNCNTVR

Gene Information

Entrez Gene ID
Gene Name
non-specific lipid-transfer protein 2
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IDA:TAIR C Golgi apparatus
GO:0005768 IDA:TAIR C endosome
GO:0005886 IDA:TAIR C plasma membrane
GO:0005802 IDA:TAIR C trans-Golgi network
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006649 NAS:TAIR P phospholipid transfer to membrane
GO:0012501 IGI:TAIR P programmed cell death
GO:0009414 IEP:TAIR P response to water deprivation

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
non-specific lipid-transfer protein 2
Protein Entry
NLTP2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}.
Similarity Belongs to the plant LTP family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010669 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15224898 RefSeq NP_181387 118 non-specific lipid-transfer protein 2

Identical Sequences to LMP010669 proteins

Reference Database Accession Length Protein Name
GI:15224898 DBBJ BAE46870.1 118 cell growth defect factor -3 [Arabidopsis thaliana]
GI:15224898 GenBank AAL24409.1 118 putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
GI:15224898 GenBank AAM10124.1 118 putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
GI:15224898 GenBank AAM63016.1 118 putative nonspecific lipid-transfer protein [Arabidopsis thaliana]
GI:15224898 GenBank AEC09546.1 118 non-specific lipid-transfer protein 2 [Arabidopsis thaliana]
GI:15224898 GenBank AFL64780.1 118 Sequence 10 from patent US 8188339

Related Sequences to LMP010669 proteins

Reference Database Accession Length Protein Name
GI:15224898 EMBL CDY18380.1 117 BnaA04g22070D [Brassica napus]
GI:15224898 GenBank AAT40130.1 117 lipid transfer protein [Brassica rapa subsp. pekinensis]
GI:15224898 GenBank EFH56010.1 118 hypothetical protein ARALYDRAFT_482863 [Arabidopsis lyrata subsp. lyrata]
GI:15224898 RefSeq XP_002879751.1 118 hypothetical protein ARALYDRAFT_482863 [Arabidopsis lyrata subsp. lyrata]
GI:15224898 RefSeq XP_009141746.1 117 PREDICTED: non-specific lipid-transfer protein B isoform X1 [Brassica rapa]
GI:15224898 RefSeq XP_009141748.1 117 PREDICTED: non-specific lipid-transfer protein B isoform X2 [Brassica rapa]