Gene/Proteome Database (LMPD)

LMPD ID
LMP010670
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
non-specific lipid-transfer protein 3
Gene Symbol
Synonyms
lipid transfer protein 3; LTP3; MNC17.10; MNC17_10
Alternate Names
non-specific lipid-transfer protein 3
Chromosome
5

Proteins

non-specific lipid-transfer protein 3
Refseq ID NP_568905
Protein GI 18424225
UniProt ID Q9LLR7
mRNA ID NM_125323
Length 115
RefSeq Status REVIEWED
MAFALRFFTCLVLTVCIVASVDAAISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMSTNCNNIK

Gene Information

Entrez Gene ID
Gene Name
non-specific lipid-transfer protein 3
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0048046 IDA:TAIR C apoplast
GO:0005618 TAS:TAIR C cell wall
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 IEA:InterPro P lipid transport
GO:0009737 IEP:TAIR P response to abscisic acid
GO:0009414 IEP:TAIR P response to water deprivation

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
non-specific lipid-transfer protein 3
Protein Entry
NLTP3_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}.
Sequence Caution Sequence=BAB09777.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the plant LTP family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010670 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18424225 RefSeq NP_568905 115 non-specific lipid-transfer protein 3

Identical Sequences to LMP010670 proteins

Reference Database Accession Length Protein Name
GI:18424225 GenBank AAN60256.1 115 unknown [Arabidopsis thaliana]
GI:18424225 GenBank ACH12135.1 115 Sequence 990 from patent US 7396979
GI:18424225 GenBank ACX16245.1 115 Sequence 43300 from patent US 7569389
GI:18424225 GenBank AEL85987.1 115 Sequence 2219 from patent US 7989676
GI:18424225 gnl TAIR 115 non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
GI:18424225 SwissProt Q9LLR7.1 115 RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 3; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010670 proteins

Reference Database Accession Length Protein Name
GI:18424225 DBBJ BAB09777.1 113 lipid transfer protein-like [Arabidopsis thaliana]
GI:18424225 GenBank AAM66088.1 115 nonspecific lipid-transfer protein precursor-like protein [Arabidopsis thaliana]
GI:18424225 GenBank EFH40885.1 115 hypothetical protein ARALYDRAFT_496059 [Arabidopsis lyrata subsp. lyrata]
GI:18424225 RefSeq XP_002864626.1 115 hypothetical protein ARALYDRAFT_496059 [Arabidopsis lyrata subsp. lyrata]
GI:18424225 RefSeq XP_010443685.1 115 PREDICTED: non-specific lipid-transfer protein 3 [Camelina sativa]
GI:18424225 RefSeq XP_010483551.1 115 PREDICTED: non-specific lipid-transfer protein 3 [Camelina sativa]