Gene/Proteome Database (LMPD)
LMPD ID
LMP010673
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
non-specific lipid-transfer protein 7
Gene Symbol
Synonyms
lipid transfer protein; lipid transfer protein 7; LTP; LTP7; T15J14.9; T15J14_9
Alternate Names
non-specific lipid-transfer protein 7
Chromosome
2
Summary
Predicted to encode a PR (pathogenesis-related) protein. Belongs to the lipid transfer protein (PR-14) family with the following members: At2g38540/LTP1, At2g38530/LTP2, At5g59320/LTP3, At5g59310/LTP4, At3g51600/LTP5, At3g08770/LTP6, At2g15050/LTP7, At2g18370/LTP8, At2g15325/LTP9, At5g01870/LTP10, At4g33355/LTP11, At3g51590/LTP12, At5g44265/LTP13, At5g62065/LTP14, At4g08530/LTP15.
Orthologs
Proteins
non-specific lipid-transfer protein 7 | |
---|---|
Refseq ID | NP_001118321 |
Protein GI | 186500492 |
UniProt ID | Q9ZUK6 |
mRNA ID | NM_001124849 |
Length | 122 |
RefSeq Status | REVIEWED |
MAGLMKLGCLVFVFVIAAGPITAKAALSCGEVNSNLKPCTGYLTNGGITSPGPQCCNGVRKLNGMVLTTLDRRQACRCIKNAARNVGPGLNADRAAGIPRRCGIKIPYSTQIRFNTKCNTVR |
Gene Information
Entrez Gene ID
Gene Name
non-specific lipid-transfer protein 7
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0006869 | IEA:InterPro | P | lipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
non-specific lipid-transfer protein 7
Protein Entry
NLTP7_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9ZUK6-1; Sequence=Displayed; Name=2; IsoId=Q9ZUK6-2; Sequence=VSP_035945, VSP_035946; Note=No experimental confirmation available.; Name=3; IsoId=Q9ZUK6-3; Sequence=VSP_035947; Note=Derived from EST data. No experimental confirmation available.; |
Function | Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}. |
Similarity | Belongs to the plant LTP family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010673 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15226046 | RefSeq | NP_179109 | 123 | non-specific lipid-transfer protein 7 |
186500492 | RefSeq | NP_001118321 | 122 | non-specific lipid-transfer protein 7 |
42570785 | RefSeq | NP_973466 | 115 | non-specific lipid-transfer protein 7 |
Identical Sequences to LMP010673 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:42570785 | DBBJ | BAD43566.1 | 115 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:15226046 | DBBJ | BAD95164.1 | 123 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:15226046 | GenBank | AAK17134.1 | 123 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:15226046 | GenBank | ABD38904.1 | 123 | At2g15050 [Arabidopsis thaliana] |
GI:15226046 | GenBank | ADT60842.1 | 123 | Sequence 2574 from patent US 7847156 |
GI:15226046 | GenBank | AEC06364.1 | 123 | non-specific lipid-transfer protein 7 [Arabidopsis thaliana] |
GI:42570785 | GenBank | AEC06365.1 | 115 | non-specific lipid-transfer protein 7 [Arabidopsis thaliana] |
GI:186500492 | GenBank | AEC06366.1 | 122 | non-specific lipid-transfer protein 7 [Arabidopsis thaliana] |
GI:15226046 | SwissProt | Q9ZUK6.1 | 123 | RecName: Full=Non-specific lipid-transfer protein 7; Short=LTP 7; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010673 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15226046 | DBBJ | BAD43566.1 | 115 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:186500492 | DBBJ | BAD95164.1 | 123 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:42570785 | DBBJ | BAD95164.1 | 123 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:42570785 | GenBank | ABD38904.1 | 123 | At2g15050 [Arabidopsis thaliana] |
GI:186500492 | GenBank | ABD38904.1 | 123 | At2g15050 [Arabidopsis thaliana] |
GI:42570785 | GenBank | ADT60842.1 | 123 | Sequence 2574 from patent US 7847156 |
GI:186500492 | GenBank | ADT60842.1 | 123 | Sequence 2574 from patent US 7847156 |
GI:15226046 | GenBank | AEC06365.1 | 115 | non-specific lipid-transfer protein 7 [Arabidopsis thaliana] |
GI:15226046 | GenBank | AEC06366.1 | 122 | non-specific lipid-transfer protein 7 [Arabidopsis thaliana] |
GI:186500492 | gnl | TIGR | 123 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:42570785 | gnl | TIGR | 123 | putative lipid transfer protein [Arabidopsis thaliana] |
GI:186500492 | RefSeq | NP_179109.1 | 123 | non-specific lipid-transfer protein 7 [Arabidopsis thaliana] |
GI:42570785 | RefSeq | NP_179109.1 | 123 | non-specific lipid-transfer protein 7 [Arabidopsis thaliana] |
GI:15226046 | RefSeq | NP_973466.1 | 115 | non-specific lipid-transfer protein 7 [Arabidopsis thaliana] |
GI:15226046 | RefSeq | NP_001118321.1 | 122 | non-specific lipid-transfer protein 7 [Arabidopsis thaliana] |
GI:15226046 | RefSeq | XP_002883875.1 | 123 | hypothetical protein ARALYDRAFT_480386 [Arabidopsis lyrata subsp. lyrata] |
GI:42570785 | SwissProt | Q9ZUK6.1 | 123 | RecName: Full=Non-specific lipid-transfer protein 7; Short=LTP 7; Flags: Precursor [Arabidopsis thaliana] |
GI:186500492 | SwissProt | Q9ZUK6.1 | 123 | RecName: Full=Non-specific lipid-transfer protein 7; Short=LTP 7; Flags: Precursor [Arabidopsis thaliana] |