Gene/Proteome Database (LMPD)

LMPD ID
LMP010677
Gene ID
836529
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Non-specific lipid-transfer protein-like protein
Gene Symbol
AT5G64080
Synonyms
MHJ24.6; MHJ24_6
Alternate Names
Non-specific lipid-transfer protein-like protein
Chromosome
5

Proteins

Non-specific lipid-transfer protein-like protein
Refseq ID NP_568984
Protein GI 18424785
UniProt ID Q8VYI9
mRNA ID NM_125804
Length 182
RefSeq Status REVIEWED
MATHSSFTATTPLFLIVLLSLSSVSVLGASHHHATAPAPSVDCSTLILNMADCLSFVSSGGTVAKPEGTCCSGLKTVLKADSQCLCEAFKSSASLGVTLNITKASTLPAACKLHAPSIATCGLSVAPSTAPGLAPGVAAAGPETAGFLAPNPSSGNDGSSLIPTSFTTVLSAVLFVLFFSSA
Non-specific lipid-transfer protein-like protein
Refseq ID NP_974989
Protein GI 42573786
UniProt ID Q8VYI9
mRNA ID NM_203260
Length 178
RefSeq Status REVIEWED
MATHSSFTATTPLFLIVLLSLSSVSVLGASHHHATAPAPSVDCSTLILNMADCLSFVSSGGTVAKPEGTCCSGLKTVLKADSQCLCEAFKSSASLGVTLNITKASTLPAACKLHAPSIATCGLSVAPSTAPGVAAAGPETAGFLAPNPSSGNDGSSLIPTSFTTVLSAVLFVLFFSSA

Gene Information

Entrez Gene ID
836529
Gene Name
Non-specific lipid-transfer protein-like protein
Gene Symbol
AT5G64080
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031225 TAS:TAIR C anchored component of membrane
GO:0046658 IDA:TAIR C anchored component of plasma membrane
GO:0008289 IEA:InterPro F lipid binding
GO:0006869 IEA:InterPro P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
Non-specific lipid-transfer protein-like protein
Protein Entry
NLTL5_ARATH
UniProt ID
Q8VYI9
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8VYI9-1; Sequence=Displayed; Name=2; IsoId=Q8VYI9-2; Sequence=VSP_021391; Note=Derived from EST data. No experimental confirmation available.;
Sequence Caution Sequence=BAB10276.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the plant LTP family. {ECO:0000305}.
Subcellular Location Cell membrane; Lipid-anchor, GPI-anchor.

Identical and Related Proteins

Unique RefSeq proteins for LMP010677 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18424785 RefSeq NP_568984 182 Non-specific lipid-transfer protein-like protein
42573786 RefSeq NP_974989 178 Non-specific lipid-transfer protein-like protein

Identical Sequences to LMP010677 proteins

Reference Database Accession Length Protein Name
GI:18424785 GenBank ABZ53436.1 182 Sequence 30 from patent US 7317140
GI:18424785 GenBank AEJ76801.1 182 Sequence 30 from patent US 7964769
GI:18424785 GenBank AFX04089.1 182 Sequence 30 from patent US 8278506
GI:18424785 GenBank AGV98098.1 182 Sequence 213 from patent US 8513488
GI:42573786 GenBank AGV98099.1 178 Sequence 214 from patent US 8513488
GI:18424785 gnl TAIR 182 Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana]
GI:42573786 gnl TAIR 178 Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana]
GI:18424785 SwissProt Q8VYI9.1 182 RecName: Full=Non-specific lipid-transfer protein-like protein At5g64080; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010677 proteins

Reference Database Accession Length Protein Name
GI:18424785 DBBJ BAB10276.1 173 unnamed protein product [Arabidopsis thaliana]
GI:42573786 GenBank AAL50083.1 182 AT5g64080/MHJ24_6 [Arabidopsis thaliana]
GI:42573786 GenBank AAM10364.1 182 AT5g64080/MHJ24_6 [Arabidopsis thaliana]
GI:18424785 GenBank AAM67186.1 182 nonspecific lipid-transfer protein-like protein [Arabidopsis thaliana]
GI:42573786 GenBank ABZ53436.1 182 Sequence 30 from patent US 7317140
GI:42573786 GenBank AGV98098.1 182 Sequence 213 from patent US 8513488
GI:18424785 GenBank AGV98099.1 178 Sequence 214 from patent US 8513488
GI:18424785 gnl TAIR 178 Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana]
GI:42573786 RefSeq NP_568984.1 182 Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana]
GI:18424785 RefSeq NP_974989.1 178 Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana]
GI:18424785 RefSeq XP_002866593.1 182 protease inhibitor/seed storage/lipid transfer protein family protein [Arabidopsis lyrata subsp. lyrata]
GI:42573786 SwissProt Q8VYI9.1 182 RecName: Full=Non-specific lipid-transfer protein-like protein At5g64080; Flags: Precursor [Arabidopsis thaliana]