Gene/Proteome Database (LMPD)

LMPD ID
LMP010698
Gene ID
828617
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
oleosin 1
Gene Symbol
OLEO1
Synonyms
F24A6.9; OLE1; OLEO1; oleosin 1; OLEOSIN 1
Alternate Names
oleosin 1
Chromosome
4
Summary
Encodes oleosin1, a protein found in oil bodies, involved in seed lipid accumulation. Suppression of OLEO1 (and OLEO2) resulted in an aberrant phenotype of embryo cells that contain unusually large oilbodies that are not normally observed in seeds. Changes in the size of oilbodies caused disruption of storage organelles, altering accumulation of lipids and proteins and causing delay in germination. Functions in freezing tolerance of seeds.
Orthologs
View orthologs and multiple alignments for OLEO1

Proteins

oleosin 1
Refseq ID NP_194244
Protein GI 15234945
UniProt ID P29525
mRNA ID NM_118646
Length 173
RefSeq Status REVIEWED
MADTARGTHHDIIGRDQYPMMGRDRDQYQMSGRGSDYSKSRQIAKAATAVTAGGSLLVLSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGFLSSGGFGIAAITVFSWIYKYATGEHPQGSDKLDSARMKLGSKAQDLKDRAQYYGQQHTGGEHDRDRTRGGQHTT

Gene Information

Entrez Gene ID
828617
Gene Name
oleosin 1
Gene Symbol
OLEO1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0012511 IEA:InterPro C monolayer-surrounded lipid storage body
GO:0019915 IMP:TAIR P lipid storage
GO:0050826 IMP:TAIR P response to freezing
GO:0009845 IGI:TAIR P seed germination
GO:0010344 IMP:TAIR P seed oilbody biogenesis

Domain Information

InterPro Annotations

Accession Description
IPR000136 Oleosin

UniProt Annotations

Entry Information

Gene Name
oleosin 1
Protein Entry
OLEO1_ARATH
UniProt ID
P29525
Species
Arabidopsis

Comments

Comment Type Description
Function May have a structural role to stabilize the lipid body during desiccation of the seed by preventing coalescence of the oil. Probably interacts with both lipid and phospholipid moieties of lipid bodies. May also provide recognition signals for specific lipase anchorage in lipolysis during seedling growth.
Ptm Ubiquitinated. {ECO:0000269|PubMed:19292762}.
Similarity Belongs to the oleosin family. {ECO:0000305}.
Subcellular Location Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Identical and Related Proteins

Unique RefSeq proteins for LMP010698 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15234945 RefSeq NP_194244 173 oleosin 1

Identical Sequences to LMP010698 proteins

Reference Database Accession Length Protein Name
GI:15234945 GenBank AAO98857.1 173 Sequence 2 from patent US 6509453
GI:15234945 GenBank AAQ22658.1 173 At4g25140 [Arabidopsis thaliana]
GI:15234945 GenBank ABA32389.1 173 Sequence 2 from patent US 6924363
GI:15234945 GenBank ACC08203.1 173 Sequence 2 from patent US 7332587
GI:15234945 GenBank AED75726.1 173 Sequence 20 from patent US 7910718
GI:15234945 GenBank AEE85016.1 173 oleosin 1 [Arabidopsis thaliana]

Related Sequences to LMP010698 proteins

Reference Database Accession Length Protein Name
GI:15234945 EMBL CBY79728.1 412 unnamed protein product [synthetic construct]
GI:15234945 GenBank ABJ28365.1 266 Sequence 11 from patent US 7091401
GI:15234945 GenBank ACW02641.1 314 Sequence 4 from patent US 7547821
GI:15234945 GenBank ACW02806.1 257 Sequence 196 from patent US 7547821
GI:15234945 GenBank AFL32954.1 412 Sequence 2 from patent US 8173435
GI:15234945 pat US 173 Sequence 2 from patent US 5792922