Gene/Proteome Database (LMPD)

LMPD ID
LMP010700
Gene ID
834040
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
oleosin 2
Gene Symbol
OLEO2
Synonyms
OLE2; OLEO2; oleosin 2; OLEOSIN 2
Alternate Names
oleosin 2
Chromosome
5

Proteins

oleosin 2
Refseq ID NP_198858
Protein GI 15242686
UniProt ID Q39165
mRNA ID NM_123406
Length 199
RefSeq Status REVIEWED
MADTHRVDRTDRHFQFQSPYEGGRGQGQYEGDRGYGGGGYKSMMPESGPSSTQVLSLLIGVPVVGSLLALAGLLLAGSVIGLMVALPLFLLFSPVIVPAALTIGLAMTGFLASGMFGLTGLSSISWVMNYLRGTRRTVPEQLEYAKRRMADAVGYAGQKGKEMGQHVQNKAQDVKQYDISKPHDTTTKGHETQGRTTAA

Gene Information

Entrez Gene ID
834040
Gene Name
oleosin 2
Gene Symbol
OLEO2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0012511 IDA:TAIR C monolayer-surrounded lipid storage body
GO:0019915 IMP:TAIR P lipid storage
GO:0050826 IMP:TAIR P response to freezing
GO:0009845 IGI:TAIR P seed germination
GO:0010344 IMP:TAIR P seed oilbody biogenesis

Domain Information

InterPro Annotations

Accession Description
IPR000136 Oleosin

UniProt Annotations

Entry Information

Gene Name
oleosin 2
Protein Entry
OLEO2_ARATH
UniProt ID
Q39165
Species
Arabidopsis

Comments

Comment Type Description
Developmental Stage In siliques, expression is first detected at stage 7 when the siliques are green-brown. Expression then rises steadily to reach a maximum at maturity. {ECO:0000269|PubMed:8756608}.
Function May have a structural role to stabilize the lipid body during desiccation of the seed by preventing coalescence of the oil. Probably interacts with both lipid and phospholipid moieties of lipid bodies. May also provide recognition signals for specific lipase anchorage in lipolysis during seedling growth (By similarity). {ECO:0000250}.
Ptm Ubiquitinated. {ECO:0000269|PubMed:19292762}.
Similarity Belongs to the oleosin family. {ECO:0000305}.
Subcellular Location Lipid droplet {ECO:0000250}. Membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface (By similarity). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010700 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15242686 RefSeq NP_198858 199 oleosin 2

Identical Sequences to LMP010700 proteins

Reference Database Accession Length Protein Name
GI:15242686 GenBank AAM47319.1 199 AT5g40420/MPO12_130 [Arabidopsis thaliana]
GI:15242686 GenBank ABW41313.1 199 Sequence 79 from patent US 7256014
GI:15242686 GenBank AED75727.1 199 Sequence 21 from patent US 7910718
GI:15242686 GenBank AGV98067.1 199 Sequence 182 from patent US 8513488
GI:15242686 gnl TAIR 199 oleosin 2 [Arabidopsis thaliana]
GI:15242686 SwissProt Q39165.1 199 RecName: Full=Oleosin 21.2 kDa; AltName: Full=Oleosin type 2 [Arabidopsis thaliana]

Related Sequences to LMP010700 proteins

Reference Database Accession Length Protein Name
GI:15242686 EMBL CAA63022.1 199 oleosin type2 [Arabidopsis thaliana]
GI:15242686 GenBank AAE34721.1 199 Sequence 8 from patent US 5977436
GI:15242686 GenBank AAE34722.1 199 Sequence 9 from patent US 5977436
GI:15242686 GenBank EFH44910.1 199 hypothetical protein ARALYDRAFT_493945 [Arabidopsis lyrata subsp. lyrata]
GI:15242686 RefSeq XP_002868651.1 199 hypothetical protein ARALYDRAFT_493945 [Arabidopsis lyrata subsp. lyrata]
GI:15242686 RefSeq XP_010441181.1 200 PREDICTED: oleosin 21.2 kDa-like [Camelina sativa]