Gene/Proteome Database (LMPD)

LMPD ID
LMP010723
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
oxysterol binding protein-related protein 3C
Gene Symbol
Synonyms
F2O15.17; F2O15_17; ORP3C; OSBP(oxysterol binding protein)-related protein 3C
Alternate Names
oxysterol binding protein-related protein 3C
Chromosome
5

Proteins

oxysterol binding protein-related protein 3C
Refseq ID NP_200750
Protein GI 15238398
UniProt ID Q93Y40
mRNA ID NM_125333
Length 457
RefSeq Status REVIEWED
MGSPKKNENKGFFAAMTSGFSMFGTAVSRSVNGVQGNEGVEVINPEGGKEDAEEEAQKGRWKDEERDSYWKMMQKYIGSDITSMVTLPVVIFEPMTMLQKMAEIMEYSHLLDQADECEDPYLRLVYASSWAISVYYAFQRTWKPFNPILGETYEMVNHGGISFISEQVSHHPPMSAGHAENEHFIYDITSKLKTKLLGNSVDVYPVGRTRVTLKKDGVVLDLVPPLTKIHNLIFGRTWVDSPGEMVMTNLTTGDKVVLYFQPCGWFGSGRYEVDGYVYSAAEEPKIMMTGKWNEKMSYQPCDAEGEPLPGTELKEVWHLADVPKNDNFQYTHFAHKINSFDTAPAKLLASDSRIRPDRYSLEQGDLSKAGSEKHSLEERQRAEKRTRETKGQKFTPRWFDLTDEITPTPWGDIEVYQYNGKYNEHRDTAESSSSASNETDLKSIEFNPWQYGNISTE

Gene Information

Entrez Gene ID
Gene Name
oxysterol binding protein-related protein 3C
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:TAIR C cytosol
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 IEA:UniProtKB-KW P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR000648 Oxysterol-binding protein
IPR018494 Oxysterol-binding protein, conserved site

UniProt Annotations

Entry Information

Gene Name
oxysterol binding protein-related protein 3C
Protein Entry
ORP3C_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function May be involved in the transport of sterols. {ECO:0000250}.
Sequence Caution Sequence=BAA97478.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the OSBP family. {ECO:0000305}.
Tissue Specificity Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:16897474}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010723 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15238398 RefSeq NP_200750 457 oxysterol binding protein-related protein 3C

Identical Sequences to LMP010723 proteins

Reference Database Accession Length Protein Name
GI:15238398 GenBank AAK96664.1 457 oxysterol-binding protein [Arabidopsis thaliana]
GI:15238398 GenBank AAN15434.1 457 oxysterol-binding protein [Arabidopsis thaliana]
GI:15238398 GenBank ADT59867.1 457 Sequence 624 from patent US 7847156
GI:15238398 gnl TAIR 457 oxysterol binding protein-related protein 3C [Arabidopsis thaliana]
GI:15238398 SwissProt Q93Y40.1 457 RecName: Full=Oxysterol-binding protein-related protein 3C; AltName: Full=OSBP-related protein 3C [Arabidopsis thaliana]

Related Sequences to LMP010723 proteins

Reference Database Accession Length Protein Name
GI:15238398 DBBJ BAA97478.1 453 oxysterol-binding protein [Arabidopsis thaliana]
GI:15238398 EMBL CDY33036.1 457 BnaA10g12420D [Brassica napus]
GI:15238398 GenBank EFH40892.1 457 oxysterol-binding family protein [Arabidopsis lyrata subsp. lyrata]
GI:15238398 GenBank ESQ42416.1 457 hypothetical protein EUTSA_v10013498mg [Eutrema salsugineum]
GI:15238398 RefSeq XP_002864633.1 457 oxysterol-binding family protein [Arabidopsis lyrata subsp. lyrata]
GI:15238398 RefSeq XP_006400963.1 457 hypothetical protein EUTSA_v10013498mg [Eutrema salsugineum]