Gene/Proteome Database (LMPD)
LMPD ID
LMP010723
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
oxysterol binding protein-related protein 3C
Gene Symbol
Synonyms
F2O15.17; F2O15_17; ORP3C; OSBP(oxysterol binding protein)-related protein 3C
Alternate Names
oxysterol binding protein-related protein 3C
Chromosome
5
Proteins
oxysterol binding protein-related protein 3C | |
---|---|
Refseq ID | NP_200750 |
Protein GI | 15238398 |
UniProt ID | Q93Y40 |
mRNA ID | NM_125333 |
Length | 457 |
RefSeq Status | REVIEWED |
MGSPKKNENKGFFAAMTSGFSMFGTAVSRSVNGVQGNEGVEVINPEGGKEDAEEEAQKGRWKDEERDSYWKMMQKYIGSDITSMVTLPVVIFEPMTMLQKMAEIMEYSHLLDQADECEDPYLRLVYASSWAISVYYAFQRTWKPFNPILGETYEMVNHGGISFISEQVSHHPPMSAGHAENEHFIYDITSKLKTKLLGNSVDVYPVGRTRVTLKKDGVVLDLVPPLTKIHNLIFGRTWVDSPGEMVMTNLTTGDKVVLYFQPCGWFGSGRYEVDGYVYSAAEEPKIMMTGKWNEKMSYQPCDAEGEPLPGTELKEVWHLADVPKNDNFQYTHFAHKINSFDTAPAKLLASDSRIRPDRYSLEQGDLSKAGSEKHSLEERQRAEKRTRETKGQKFTPRWFDLTDEITPTPWGDIEVYQYNGKYNEHRDTAESSSSASNETDLKSIEFNPWQYGNISTE |
Gene Information
Entrez Gene ID
Gene Name
oxysterol binding protein-related protein 3C
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IDA:TAIR | C | cytosol |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0006869 | IEA:UniProtKB-KW | P | lipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
oxysterol binding protein-related protein 3C
Protein Entry
ORP3C_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Function | May be involved in the transport of sterols. {ECO:0000250}. |
Sequence Caution | Sequence=BAA97478.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
Similarity | Belongs to the OSBP family. {ECO:0000305}. |
Tissue Specificity | Expressed in roots, leaves, stems and flowers. {ECO:0000269|PubMed:16897474}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010723 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15238398 | RefSeq | NP_200750 | 457 | oxysterol binding protein-related protein 3C |
Identical Sequences to LMP010723 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15238398 | GenBank | AAK96664.1 | 457 | oxysterol-binding protein [Arabidopsis thaliana] |
GI:15238398 | GenBank | AAN15434.1 | 457 | oxysterol-binding protein [Arabidopsis thaliana] |
GI:15238398 | GenBank | ADT59867.1 | 457 | Sequence 624 from patent US 7847156 |
GI:15238398 | gnl | TAIR | 457 | oxysterol binding protein-related protein 3C [Arabidopsis thaliana] |
GI:15238398 | SwissProt | Q93Y40.1 | 457 | RecName: Full=Oxysterol-binding protein-related protein 3C; AltName: Full=OSBP-related protein 3C [Arabidopsis thaliana] |
Related Sequences to LMP010723 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15238398 | DBBJ | BAA97478.1 | 453 | oxysterol-binding protein [Arabidopsis thaliana] |
GI:15238398 | EMBL | CDY33036.1 | 457 | BnaA10g12420D [Brassica napus] |
GI:15238398 | GenBank | EFH40892.1 | 457 | oxysterol-binding family protein [Arabidopsis lyrata subsp. lyrata] |
GI:15238398 | GenBank | ESQ42416.1 | 457 | hypothetical protein EUTSA_v10013498mg [Eutrema salsugineum] |
GI:15238398 | RefSeq | XP_002864633.1 | 457 | oxysterol-binding family protein [Arabidopsis lyrata subsp. lyrata] |
GI:15238398 | RefSeq | XP_006400963.1 | 457 | hypothetical protein EUTSA_v10013498mg [Eutrema salsugineum] |