Gene/Proteome Database (LMPD)

LMPD ID
LMP010728
Gene ID
837372
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
fatty acyl-ACP thioesterases B
Gene Symbol
FATB
Synonyms
fatty acyl-ACP thioesterases B; T27G7.19; T27G7_19
Alternate Names
fatty acyl-ACP thioesterases B
Chromosome
1
EC Number
3.1.2.-
Summary
Encodes an acyl-acyl carrier protein thioesterase. Hydrolyzes primarily saturated acyl-ACPs with chain lengths that vary between 8 and 18 carbons. Involved in saturated fatty acid synthesis. Nuclear-encoded, plastid-targeted globular protein that is functional as dimer.
Orthologs
View orthologs and multiple alignments for FATB

Proteins

fatty acyl-ACP thioesterases B
Refseq ID NP_172327
Protein GI 15223236
UniProt ID Q9SJE2
mRNA ID NM_100724
Length 412
RefSeq Status REVIEWED
MVATSATSSFFPVPSSSLDPNGKGNKIGSTNLAGLNSAPNSGRMKVKPNAQAPPKINGKKVGLPGSVDIVRTDTETSSHPAPRTFINQLPDWSMLLAAITTIFLAAEKQWMMLDWKPRRSDMLVDPFGIGRIVQDGLVFRQNFSIRSYEIGADRSASIETVMNHLQETALNHVKTAGLLGDGFGSTPEMFKKNLIWVVTRMQVVVDKYPTWGDVVEVDTWVSQSGKNGMRRDWLVRDCNTGETLTRASSVWVMMNKLTRRLSKIPEEVRGEIEPYFVNSDPVLAEDSRKLTKIDDKTADYVRSGLTPRWSDLDVNQHVNNVKYIGWILESAPVGIMERQKLKSMTLEYRRECGRDSVLQSLTAVTGCDIGNLATAGDVECQHLLRLQDGAEVVRGRTEWSSKTPTTTWGTAP

Gene Information

Entrez Gene ID
837372
Gene Name
fatty acyl-ACP thioesterases B
Gene Symbol
FATB
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IEA:UniProtKB-KW C chloroplast
GO:0009536 TAS:TAIR C plastid
GO:0000036 IDA:TAIR F ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process
GO:0016297 IDA:TAIR F acyl-[acyl-carrier-protein] hydrolase activity
GO:0006633 IMP:TAIR P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00061 Fatty acid biosynthesis
ath01212 Fatty acid metabolism
ath01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5366 palmitoleate biosynthesis II

Domain Information

InterPro Annotations

Accession Description
IPR002864 Acyl-ACP thioesterase
IPR021113 Acyl-ACP-thioesterase, N-terminal
IPR029069 HotDog domain

UniProt Annotations

Entry Information

Gene Name
fatty acyl-ACP thioesterases B
Protein Entry
FATB_ARATH
UniProt ID
Q9SJE2
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=2.9 uM for myristoyl-ACP (14:0-ACP) {ECO:0000269|PubMed:12061798}; KM=4.0 uM for myristoleoyl-ACP (14:1-ACP) {ECO:0000269|PubMed:12061798}; KM=3.8 uM for palmitoyl-ACP (16:0-ACP) {ECO:0000269|PubMed:12061798}; KM=2.6 uM for palmitoleoyl-ACP (16:1-ACP) {ECO:0000269|PubMed:12061798}; KM=3.0 uM for stearoyl-ACP (18:0-ACP) {ECO:0000269|PubMed:12061798}; KM=2.6 uM for oleoyl-ACP (18:1-ACP) {ECO:0000269|PubMed:12061798}; Note=The catalytic efficiency for 16:0 is at least 2-fold higher than for other substrates.; pH dependence: Optimum pH is 9.7 {ECO:0000269|PubMed:7840673};
Catalytic Activity Palmitoyl-[acyl-carrier-protein] + H(2)O = [acyl-carrier-protein] + palmitate. {ECO:0000269|PubMed:12061798, ECO:0000269|PubMed:7840673}.
Disruption Phenotype Retarded growth, deformed seeds with low rate of germination and reduced levels of palmitate and stearate. {ECO:0000269|PubMed:12671095, ECO:0000269|PubMed:18263779, ECO:0000269|PubMed:18326828}.
Function Plays an essential role in chain termination during de novo fatty acid synthesis. Possesses high thioesterase activity for palmitoyl-ACP versus other acyl-ACPs. Substrate preference is 16:0 > 18:1 > 18:0 > 16:1. Plays an essential role in the supply of saturated fatty acids necessary for plant growth and seed development. Contributes to 16:0 production particularly in flowers. May be involved in the synthesis of long chain fatty acid. {ECO:0000269|PubMed:10859193, ECO:0000269|PubMed:12061798, ECO:0000269|PubMed:12671095, ECO:0000269|PubMed:15531590, ECO:0000269|PubMed:18263779, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:7840673}.
Miscellaneous Plants silencing FATB, show reduced level of palmitate in flowers and seeds. {ECO:0000305|PubMed:10859193}.
Similarity Belongs to the acyl-ACP thioesterase family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast {ECO:0000305}.
Tissue Specificity Highly expressed in flowers. Expressed in roots, leaves, stems, siliques and seeds. {ECO:0000269|PubMed:10859193, ECO:0000269|PubMed:7840673}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010728 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15223236 RefSeq NP_172327 412 fatty acyl-ACP thioesterases B

Identical Sequences to LMP010728 proteins

Reference Database Accession Length Protein Name
GI:15223236 GenBank AEE28300.1 412 fatty acyl-ACP thioesterases B [Arabidopsis thaliana]
GI:15223236 GenBank AGE99615.1 412 Sequence 2 from patent US 8361173
GI:15223236 GenBank AGF22772.1 412 Sequence 68 from patent US 8372610
GI:15223236 GenBank AGV92057.1 412 Sequence 210 from patent US 8530221
GI:15223236 GenBank AHE24007.1 412 Sequence 208 from patent US 8592188
GI:15223236 SwissProt Q9SJE2.1 412 RecName: Full=Palmitoyl-acyl carrier protein thioesterase, chloroplastic; AltName: Full=16:0-acyl-carrier protein thioesterase; Short=16:0-ACP thioesterase; AltName: Full=Acyl-[acyl-carrier-protein] hydrolase; AltName: Full=Acyl-acyl carrier protein thioesterase B1; Short=AtFATB1; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010728 proteins

Reference Database Accession Length Protein Name
GI:15223236 EMBL CAA85387.1 412 acyl-(acyl carrier protein) thioesterase [Arabidopsis thaliana]
GI:15223236 EMBL CAA85388.1 412 acyl-(acyl carrier protein) thioesterase [Arabidopsis thaliana]
GI:15223236 GenBank EFH68720.1 411 fatty acyl-acp thioesterases B [Arabidopsis lyrata subsp. lyrata]
GI:15223236 GenBank AHE24008.1 412 Sequence 209 from patent US 8592188
GI:15223236 GenBank AHE24009.1 412 Sequence 210 from patent US 8592188
GI:15223236 RefSeq XP_002892461.1 411 fatty acyl-acp thioesterases B [Arabidopsis lyrata subsp. lyrata]