Gene/Proteome Database (LMPD)
LMPD ID
LMP010739
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
patellin-1
Gene Symbol
Synonyms
PATELLIN 1; PATL1; T9N14.1; T9N14_1
Alternate Names
patellin-1
Chromosome
1
Summary
novel cell-plate-associated protein that is related in sequence to proteins involved in membrane trafficking in other eukaryotes
Orthologs
Proteins
| patellin-1 | |
|---|---|
| Refseq ID | NP_177360 |
| Protein GI | 15218382 |
| UniProt ID | Q56WK6 |
| mRNA ID | NM_105873 |
| Length | 573 |
| RefSeq Status | REVIEWED |
| MAQEEVQKSADVAAAPVVKEKPITDKEVTIPTPVAEKEEVAAPVSDEKAVPEKEVTPEKEAPAAEAEKSVSVKEEETVVVAEKVVVLTAEEVQKKALEEFKELVREALNKREFTAPVTPVKEEKTEEKKTEEETKEEEKTEEKKEETTTEVKVEEEKPAVPAAEEEKSSEAAPVETKSEEKPEEKAEVTTEKASSAEEDGTKTVEAIEESIVSVSPPESAVAPVVVETVAVAEAEPVEPEEVSIWGVPLLQDERSDVILTKFLRARDFKVKEALTMLKNTVQWRKENKIDELVESGEEVSEFEKMVFAHGVDKEGHVVIYSSYGEFQNKELFSDKEKLNKFLSWRIQLQEKCVRAIDFSNPEAKSSFVFVSDFRNAPGLGKRALWQFIRRAVKQFEDNYPEFAAKELFINVPWWYIPYYKTFGSIITSPRTRSKMVLAGPSKSADTIFKYIAPEQVPVKYGGLSKDTPLTEETITEAIVKPAANYTIELPASEACTLSWELRVLGADVSYGAQFEPTTEGSYAVIVSKTRKIGSTDEPVITDSFKVGEPGKIVITIDNQTSKKKKVLYRFKTQ | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0048046 | IDA:TAIR | C | apoplast |
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0005794 | IDA:TAIR | C | Golgi apparatus |
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0016020 | IDA:TAIR | C | membrane |
| GO:0005886 | IDA:TAIR | C | plasma membrane |
| GO:0009506 | IDA:TAIR | C | plasmodesma |
| GO:0005773 | IDA:TAIR | C | vacuole |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0002020 | IPI:UniProtKB | F | protease binding |
| GO:0007049 | IEA:UniProtKB-KW | P | cell cycle |
| GO:0051301 | IEA:UniProtKB-KW | P | cell division |
| GO:0009860 | IEP:TAIR | P | pollen tube growth |
| GO:0006810 | IEA:UniProtKB-KW | P | transport |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | Accumulates during flower development (at protein level). {ECO:0000269|PubMed:15466235}. |
| Function | Carrier protein that may be involved in membrane- trafficking events associated with cell plate formation during cytokinesis. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds to phosphoinositides with a preference for PtdIns(5)P, PtdIns(4,5)P2 and PtdIns(3)P. {ECO:0000269|PubMed:15466235}. |
| Miscellaneous | 'Patella' means 'small plate' in Latin. |
| Ptm | Ubiquitinated. {ECO:0000269|PubMed:19292762}. |
| Similarity | Belongs to the patellin family. {ECO:0000305}. |
| Similarity | Contains 1 CRAL-TRIO domain. {ECO:0000255|PROSITE- ProRule:PRU00056}. |
| Similarity | Contains 1 GOLD domain. {ECO:0000255|PROSITE- ProRule:PRU00096}. |
| Subcellular Location | Membrane {ECO:0000269|PubMed:15466235}. Cytoplasm {ECO:0000269|PubMed:15466235}. Note=Mainly membrane- associated. Also cytoplasmic. Cell plate during cell division. |
| Subunit | Interacts with the deubiquitinating enzyme AMSH3. {ECO:0000269|PubMed:20543027}. |
| Tissue Specificity | Expressed ubiquitously with higher levels in expanding roots and leaves (at protein level). {ECO:0000269|PubMed:15466235}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010739 (as displayed in Record Overview)
Identical Sequences to LMP010739 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15218382 | EMBL | CBX86380.1 | 573 | unnamed protein product [Arabidopsis thaliana] |
| GI:15218382 | GenBank | AAG51793.1 | 573 | cytosolic factor, putative; 12503-14597 [Arabidopsis thaliana] |
| GI:15218382 | GenBank | AAK76587.1 | 573 | putative cytosolic factor [Arabidopsis thaliana] |
| GI:15218382 | GenBank | AAM44913.1 | 573 | putative cytosolic factor protein [Arabidopsis thaliana] |
| GI:15218382 | GenBank | AEE35282.1 | 573 | patellin-1 [Arabidopsis thaliana] |
| GI:15218382 | SwissProt | Q56WK6.2 | 573 | RecName: Full=Patellin-1 [Arabidopsis thaliana] |
Related Sequences to LMP010739 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15218382 | GenBank | EFH63677.1 | 554 | hypothetical protein ARALYDRAFT_895064 [Arabidopsis lyrata subsp. lyrata] |
| GI:15218382 | GenBank | EOA34977.1 | 567 | hypothetical protein CARUB_v10020065mg [Capsella rubella] |
| GI:15218382 | RefSeq | XP_002887418.1 | 554 | hypothetical protein ARALYDRAFT_895064 [Arabidopsis lyrata subsp. lyrata] |
| GI:15218382 | RefSeq | XP_006302079.1 | 567 | hypothetical protein CARUB_v10020065mg [Capsella rubella] |
| GI:15218382 | RefSeq | XP_010415949.1 | 567 | PREDICTED: patellin-1-like isoform X2 [Camelina sativa] |
| GI:15218382 | RefSeq | XP_010428078.1 | 575 | PREDICTED: patellin-1 [Camelina sativa] |