Gene/Proteome Database (LMPD)
LMPD ID
LMP010755
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
peroxisomal adenine nucleotide carrier 1
Gene Symbol
Synonyms
peroxisomal adenine nucleotide carrier 1; PNC1; T12H1.26; T12H1_26
Alternate Names
peroxisomal adenine nucleotide carrier 1
Chromosome
3
Summary
encodes a peroxisomal adenine nucleotide transporter, involved in fatty acid beta-oxidation during early stage of postgerminative growth.
Orthologs
Proteins
| peroxisomal adenine nucleotide carrier 1 | |
|---|---|
| Refseq ID | NP_566251 |
| Protein GI | 18397181 |
| UniProt ID | Q9MA90 |
| mRNA ID | NM_111402 |
| Length | 322 |
| RefSeq Status | REVIEWED |
| MGVDLESVSEATSGAIGSLLSTTILYPLDTCKSKFQAEVRARGQQKYRYLSDVMWEAISKGQVFSLYQGLGTKNFQSFISQFIYFYSYSYFKRVHSERTGSKSIGTKANLLIAAAAGACTSVLIQPLDTASSRMQTSEFGESKGLWKTLTEGSWADAFDGLGISLLLTSNPAIQYTVFDQLKQHLLKQKNAKAENGSSPVVLSAFMAFVLGAVSKSVATVLTYPAIRCKVMIQAADESKENETKKPRRRTRKTIPGVVYAIWRKEGMLGFFKGLQAQILKTVLSSALLLMIKEKITATTWILILAIRRTLFLTNTKGKLRSP | |
Gene Information
Entrez Gene ID
Gene Name
peroxisomal adenine nucleotide carrier 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005777 | IDA:TAIR | C | peroxisome |
| GO:0015217 | IDA:TAIR | F | ADP transmembrane transporter activity |
| GO:0005347 | IDA:TAIR | F | ATP transmembrane transporter activity |
| GO:0015297 | IEA:UniProtKB-KW | F | antiporter activity |
| GO:0015866 | IDA:TAIR | P | ADP transport |
| GO:0015867 | IDA:TAIR | P | ATP transport |
| GO:0006635 | IMP:TAIR | P | fatty acid beta-oxidation |
| GO:0080024 | IMP:TAIR | P | indolebutyric acid metabolic process |
| GO:0090351 | IGI:TAIR | P | seedling development |
Domain Information
UniProt Annotations
Entry Information
Gene Name
peroxisomal adenine nucleotide carrier 1
Protein Entry
PNC1_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=83 uM for ATP {ECO:0000269|PubMed:19073763}; |
| Developmental Stage | Expressed in the early seedling stage of post-germinative growth. {ECO:0000269|PubMed:19073762}. |
| Function | Peroxisomal adenine nucleotide transporter catalyzing the counterexchange of ATP with AMP. ATP is needed by reactions that generate acyl-CoA for peroxisomal fatty acid beta-oxidation during postgerminative growth. Required for the beta-oxidation reactions involved in auxin biosynthesis and for the conversion of seed-reserved triacylglycerols into sucrose that is necessary for growth before the onset of photosynthesis. {ECO:0000269|PubMed:19073762, ECO:0000269|PubMed:19073763}. |
| Similarity | Belongs to the mitochondrial carrier (TC 2.A.29) family. {ECO:0000305}. |
| Similarity | Contains 3 Solcar repeats. {ECO:0000255|PROSITE- ProRule:PRU00282}. |
| Subcellular Location | Peroxisome membrane {ECO:0000269|PubMed:19073762, ECO:0000269|PubMed:19073763}; Multi- pass membrane protein {ECO:0000269|PubMed:19073762, ECO:0000269|PubMed:19073763}. |
| Tissue Specificity | Expressed in stamens, pollen grains, seeds, leaves, cotyledons, roots, stems, flowers, hypocotyls and siliques. {ECO:0000269|PubMed:19073763}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010755 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18397181 | RefSeq | NP_566251 | 322 | peroxisomal adenine nucleotide carrier 1 |
Identical Sequences to LMP010755 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18397181 | EMBL | CAX07925.1 | 322 | unnamed protein product [Arabidopsis thaliana] |
| GI:18397181 | EMBL | CAX01388.1 | 322 | unnamed protein product [Arabidopsis thaliana] |
| GI:18397181 | EMBL | CBD33309.1 | 322 | unnamed protein product [Arabidopsis thaliana] |
| GI:18397181 | EMBL | CBD04712.1 | 322 | unnamed protein product [Arabidopsis thaliana] |
| GI:18397181 | EMBL | CBD16941.1 | 322 | unnamed protein product [Arabidopsis thaliana] |
| GI:18397181 | GenBank | AEE74216.1 | 322 | peroxisomal adenine nucleotide carrier 1 [Arabidopsis thaliana] |
Related Sequences to LMP010755 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18397181 | GenBank | AAM66025.1 | 322 | unknown [Arabidopsis thaliana] |
| GI:18397181 | GenBank | EFH60758.1 | 322 | mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18397181 | GenBank | EOA31053.1 | 320 | hypothetical protein CARUB_v10014204mg [Capsella rubella] |
| GI:18397181 | RefSeq | XP_002884499.1 | 322 | mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18397181 | RefSeq | XP_006298155.1 | 320 | hypothetical protein CARUB_v10014204mg [Capsella rubella] |
| GI:18397181 | RefSeq | XP_010425345.1 | 322 | PREDICTED: peroxisomal adenine nucleotide carrier 1 [Camelina sativa] |