Gene/Proteome Database (LMPD)

LMPD ID
LMP010755
Gene ID
819693
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
peroxisomal adenine nucleotide carrier 1
Gene Symbol
PNC1
Synonyms
peroxisomal adenine nucleotide carrier 1; PNC1; T12H1.26; T12H1_26
Alternate Names
peroxisomal adenine nucleotide carrier 1
Chromosome
3
Summary
encodes a peroxisomal adenine nucleotide transporter, involved in fatty acid beta-oxidation during early stage of postgerminative growth.
Orthologs
View orthologs and multiple alignments for PNC1

Proteins

peroxisomal adenine nucleotide carrier 1
Refseq ID NP_566251
Protein GI 18397181
UniProt ID Q9MA90
mRNA ID NM_111402
Length 322
RefSeq Status REVIEWED
MGVDLESVSEATSGAIGSLLSTTILYPLDTCKSKFQAEVRARGQQKYRYLSDVMWEAISKGQVFSLYQGLGTKNFQSFISQFIYFYSYSYFKRVHSERTGSKSIGTKANLLIAAAAGACTSVLIQPLDTASSRMQTSEFGESKGLWKTLTEGSWADAFDGLGISLLLTSNPAIQYTVFDQLKQHLLKQKNAKAENGSSPVVLSAFMAFVLGAVSKSVATVLTYPAIRCKVMIQAADESKENETKKPRRRTRKTIPGVVYAIWRKEGMLGFFKGLQAQILKTVLSSALLLMIKEKITATTWILILAIRRTLFLTNTKGKLRSP

Gene Information

Entrez Gene ID
819693
Gene Name
peroxisomal adenine nucleotide carrier 1
Gene Symbol
PNC1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005777 IDA:TAIR C peroxisome
GO:0015217 IDA:TAIR F ADP transmembrane transporter activity
GO:0015297 IEA:UniProtKB-KW F antiporter activity
GO:0005347 IDA:TAIR F ATP transmembrane transporter activity
GO:0015866 IDA:TAIR P ADP transport
GO:0015867 IDA:TAIR P ATP transport
GO:0006635 IMP:TAIR P fatty acid beta-oxidation
GO:0080024 IMP:TAIR P indolebutyric acid metabolic process
GO:0090351 IGI:TAIR P seedling development

Domain Information

InterPro Annotations

Accession Description
IPR023395 Mitochondrial carrier domain
IPR018108 Mitochondrial substrate/solute carrier

UniProt Annotations

Entry Information

Gene Name
peroxisomal adenine nucleotide carrier 1
Protein Entry
PNC1_ARATH
UniProt ID
Q9MA90
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=83 uM for ATP {ECO:0000269|PubMed:19073763};
Developmental Stage Expressed in the early seedling stage of post-germinative growth. {ECO:0000269|PubMed:19073762}.
Function Peroxisomal adenine nucleotide transporter catalyzing the counterexchange of ATP with AMP. ATP is needed by reactions that generate acyl-CoA for peroxisomal fatty acid beta-oxidation during postgerminative growth. Required for the beta-oxidation reactions involved in auxin biosynthesis and for the conversion of seed-reserved triacylglycerols into sucrose that is necessary for growth before the onset of photosynthesis. {ECO:0000269|PubMed:19073762, ECO:0000269|PubMed:19073763}.
Similarity Belongs to the mitochondrial carrier (TC 2.A.29) family. {ECO:0000305}.
Similarity Contains 3 Solcar repeats. {ECO:0000255|PROSITE- ProRule:PRU00282}.
Subcellular Location Peroxisome membrane {ECO:0000269|PubMed:19073762, ECO:0000269|PubMed:19073763}; Multi- pass membrane protein {ECO:0000269|PubMed:19073762, ECO:0000269|PubMed:19073763}.
Tissue Specificity Expressed in stamens, pollen grains, seeds, leaves, cotyledons, roots, stems, flowers, hypocotyls and siliques. {ECO:0000269|PubMed:19073763}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010755 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18397181 RefSeq NP_566251 322 peroxisomal adenine nucleotide carrier 1

Identical Sequences to LMP010755 proteins

Reference Database Accession Length Protein Name
GI:18397181 EMBL CAX07925.1 322 unnamed protein product [Arabidopsis thaliana]
GI:18397181 EMBL CAX01388.1 322 unnamed protein product [Arabidopsis thaliana]
GI:18397181 EMBL CBD33309.1 322 unnamed protein product [Arabidopsis thaliana]
GI:18397181 EMBL CBD04712.1 322 unnamed protein product [Arabidopsis thaliana]
GI:18397181 EMBL CBD16941.1 322 unnamed protein product [Arabidopsis thaliana]
GI:18397181 GenBank AEE74216.1 322 peroxisomal adenine nucleotide carrier 1 [Arabidopsis thaliana]

Related Sequences to LMP010755 proteins

Reference Database Accession Length Protein Name
GI:18397181 GenBank AAM66025.1 322 unknown [Arabidopsis thaliana]
GI:18397181 GenBank EFH60758.1 322 mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata]
GI:18397181 GenBank EOA31053.1 320 hypothetical protein CARUB_v10014204mg [Capsella rubella]
GI:18397181 RefSeq XP_002884499.1 322 mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata]
GI:18397181 RefSeq XP_006298155.1 320 hypothetical protein CARUB_v10014204mg [Capsella rubella]
GI:18397181 RefSeq XP_010425345.1 322 PREDICTED: peroxisomal adenine nucleotide carrier 1 [Camelina sativa]